DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha2 and HTR3A

DIOPT Version :9

Sequence 1:NP_524482.1 Gene:nAChRalpha2 / 42919 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_998786.3 Gene:HTR3A / 3359 HGNCID:5297 Length:510 Species:Homo sapiens


Alignment Length:568 Identity:132/568 - (23%)
Similarity:250/568 - (44%) Gaps:129/568 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLLLLCETVQANPDAK-----------RLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDL 84
            :|.||..|:.|..:|:           ||.|.||:||.:.:|||.:......|.:.:.:..::::
Human     9 LLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNV 73

  Fly    85 NLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKA 149
            :.|:|:|||.:|....|.|...:|:|.::..:|:|.:|::.||:|||::     .|:|....:..
Human    74 DEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILI-----NEFVDVGKSPN 133

  Fly   150 I----LHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSW--TYDGDQIDLKHISQKNDK 208
            |    :.:.|:|....|....::|.:|:..||||.|.|.:.|.||  |.....|.|..:.:|...
Human   134 IPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKS 198

  Fly   209 DNKVEIGIDLREYYPSVEWDILGV-PAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPC 272
            |..|        :....||::||| |..|  ::....:..|.::.|.:.:||:.|||.|:|::|.
Human   199 DRSV--------FMNQGEWELLGVLPYFR--EFSMESSNYYAEMKFYVVIRRRPLFYVVSLLLPS 253

  Fly   273 VGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGK----------- 326
            :.:..:.::.||||.:|||:::..|::||..::|.:::|:.:|:|::..||:||           
Human   254 IFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAIGTPLIGKAPPGSRAQSGE 318

  Fly   327 ---------------------YLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRL 370
                                 |.:..|.|:.:|:..||.|:.:.:::.....:..|:|...::|:
Human   319 KPAPSHLLHVSLASALGCTGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERI 383

  Fly   371 PKLLLMRVPKDLLRDLAANKINYGLKFSKTKFGQALMDEMQMNSGGSSPDSLRRMQGRVGAGGCN 435
            ..||.:|......|..|.::                                             
Human   384 AWLLCLREQSTSQRPPATSQ--------------------------------------------- 403

  Fly   436 GMHVTTATNRFSGLVGALGGGLSTLSGYNGLPSVLSGLDDSLSDVAARKKYPFELEKAI----HN 496
                .|.|:..|    |:|...|.:.|    |   ...:.|..|..:....|.|...|:    ..
Human   404 ----ATKTDDCS----AMGNHCSHMGG----P---QDFEKSPRDRCSPPPPPREASLAVCGLLQE 453

  Fly   497 VMFIQHHMQRQDEFNAEDQDWGFVAMVMDRLFLWLFMIASLVGTFVIL 544
            :..|:..::::||.....:||..|..|:|:|...::::|.|..:..::
Human   454 LSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha2NP_524482.1 LGIC_ECD_nAChR_proto_alpha-like 44..263 CDD:349832 64/236 (27%)
LIC 47..544 CDD:273305 126/539 (23%)
HTR3ANP_998786.3 LIC 23..504 CDD:273305 127/554 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.