DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha2 and CG8916

DIOPT Version :9

Sequence 1:NP_524482.1 Gene:nAChRalpha2 / 42919 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_573090.3 Gene:CG8916 / 32553 FlyBaseID:FBgn0030707 Length:612 Species:Drosophila melanogaster


Alignment Length:316 Identity:63/316 - (19%)
Similarity:146/316 - (46%) Gaps:38/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSE 112
            :.::||..|.:...|........:|:..:.:..:..::..|...:.:.:....|:|.:..:.   
  Fly   111 ILENLLKRYEQSQLPTHGQGVPTVVQTNILIRSMGPVSELDMDYSMDCYFRQYWRDKRLSFK--- 172

  Fly   113 YGGVTELYVP---SEHIWLPDIVLYNNADGE-YVVTTMTKAI-LHYTGKVVWTPPAIFKSSCEID 172
             |.:..|.:.   .:.||.||...||....: :::|...|.: |...|.::::.....|::|.::
  Fly   173 -GPIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQNGGILYSMRLTIKATCPME 236

  Fly   173 VRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEI--GIDLREYYPSVEWDILGVPAE 235
            ::.||.|:|:|.:..||:.|...|:    |.:..::|:.|..  |:.|.::      |::.:   
  Fly   237 LQNFPMDRQSCPLVIGSYGYINQQL----IYEWKNQDDAVSFVPGMTLNQF------DLISM--- 288

  Fly   236 RHEKYYPCCAE-PYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPAD-SGEKIALCIS 298
            .|..:.....| .:..:.....|:|.|.::.:.:.:||:.|..||.:.|::..: :.::::||::
  Fly   289 MHRNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVT 353

  Fly   299 ILLSQTMFFLLISEIIPSTSLALPLLGKY---LLFTMLLVGLSVVITII-ILNIHY 350
            .:|:       :|.|...:...||.: ||   |.:.:|:..|..:.|:: ...:||
  Fly   354 SVLT-------LSTISLDSRTDLPKV-KYATALDWFLLMSFLYCIATLLEFAGVHY 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha2NP_524482.1 LGIC_ECD_nAChR_proto_alpha-like 44..263 CDD:349832 42/222 (19%)
LIC 47..544 CDD:273305 63/316 (20%)
CG8916NP_573090.3 LIC 92..598 CDD:273305 63/316 (20%)
Neur_chan_LBD 111..315 CDD:280998 41/220 (19%)
Neur_chan_memb 322..>403 CDD:280999 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.