DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha2 and HTR3D

DIOPT Version :9

Sequence 1:NP_524482.1 Gene:nAChRalpha2 / 42919 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001157118.1 Gene:HTR3D / 200909 HGNCID:24004 Length:454 Species:Homo sapiens


Alignment Length:340 Identity:69/340 - (20%)
Similarity:133/340 - (39%) Gaps:70/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVP 122
            :.|.||:|.:....|.:...||.:  .|...:|.|.|......|.:...:|:|.|.||:.:..:.
Human    51 KAIGPVTNYSVATHVNISFTLSAI--WNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMA 113

  Fly   123 SEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVV----------WTP---PAIFKSSCEIDVR 174
            :|::||.|:.:..:.|........:.:|:..|...:          |||   |::.::.      
Human   114 TENLWLSDVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRAR------ 172

  Fly   175 YFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEK 239
                          :|........:.|.:                .:....||.:||:  ::...
Human   173 --------------AWRRMSRSFQIHHRT----------------SFRTRREWVLLGI--QKRTI 205

  Fly   240 YYPCCAEPYPDIFFNITLRR--KTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLS 302
            ........|....|::.:||  :...|.||.::|...:..:..|.||||.:||......:::||.
Human   206 KVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPSGILIAIDALSFYLPLESGNCAPFKMTVLLG 270

  Fly   303 QTMFFLLISEIIPST------SLALPL--------LGKYLLFTMLLVGLSVVITIIILN-IHYRK 352
            .::|.|::::::|:|      ||..||        .|.|....:.|:..|::.||.|.: :|...
Human   271 YSVFLLMMNDLLPATSTSSHASLVAPLALMQTPLPAGVYFALCLSLMVGSLLETIFITHLLHVAT 335

  Fly   353 PSTHKMRPWIRSFFI 367
            .....:..|:.|..:
Human   336 TQPLPLPRWLHSLLL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha2NP_524482.1 LGIC_ECD_nAChR_proto_alpha-like 44..263 CDD:349832 38/219 (17%)
LIC 47..544 CDD:273305 69/340 (20%)
HTR3DNP_001157118.1 Neur_chan_LBD 55..>130 CDD:280998 20/76 (26%)
LIC 92..452 CDD:273305 58/297 (20%)
Neur_chan_memb 237..>351 CDD:280999 28/114 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.