DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha2 and CHRNB3

DIOPT Version :9

Sequence 1:NP_524482.1 Gene:nAChRalpha2 / 42919 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_000740.1 Gene:CHRNB3 / 1142 HGNCID:1963 Length:458 Species:Homo sapiens


Alignment Length:536 Identity:205/536 - (38%)
Similarity:305/536 - (56%) Gaps:101/536 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLVLLLL---------CETVQANPDAKRLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDL 84
            :|||::|         ..::..|.||  |...|...|.:.:|||.::.||:.|..||::|||:|:
Human     6 MLVLIVLGIPSSATTGFNSIAENEDA--LLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDV 68

  Fly    85 NLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKA 149
            :.|:|::||||||:.||.|||.:|:|.:|||:..:.||||.:|||||||:.||||.:..:.|||.
Human    69 DEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKV 133

  Fly   150 ILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEI 214
            |:...|.|||||||.:||||.:||.:||||:|.|.||||||||||..:||..|::          
Human   134 IVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINE---------- 188

  Fly   215 GIDLREYYPSVEWDIL---GVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGIS 276
            .:|.::::.:.||:||   |:...|.:..|     .||.|.::..|||..||||:.|||||:|:|
Human   189 NVDRKDFFDNGEWEILNAKGMKGNRRDGVY-----SYPFITYSFVLRRLPLFYTLFLIIPCLGLS 248

  Fly   277 YLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVI 341
            :|:|||||||:|.|||::|..|:|:|.|:|.|:|.|||||:|..:||:|:||||.|:.|.||:::
Human   249 FLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIV 313

  Fly   342 TIIILNIHYRKPST-HKMRPWIRSFFIKRLPKLLLMRVPKDLLRDLAANKINYGLKFSKTKFGQA 405
            |:.::|:|:|..|| |.|.||::..|:::|||||.|:                            
Human   314 TVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMK---------------------------- 350

  Fly   406 LMDEMQMNSGGSSPDSLRRMQGRVGAGGCNGMHVTTATNRFSGLVGALGGGLSTLSGYNGLPSVL 470
              |.:...|.....:|...::|:|                                       :.
Human   351 --DHVDRYSSPEKEESQPVVKGKV---------------------------------------LE 374

  Fly   471 SGLDDSLSDVAARKKYPFELEKAIHNVMFIQHHMQRQDEFNAEDQDWGFVAMVMDRLFLWLFMIA 535
            ......|||  ..|.....||||..::.:|..|::::...:...|||.|||.|:||:|||||:|.
Human   375 KKKQKQLSD--GEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWKFVAQVLDRIFLWLFLIV 437

  Fly   536 SLVGTFVILGEAPSLY 551
            |:.|:.:|...|..::
Human   438 SVTGSVLIFTPALKMW 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha2NP_524482.1 LGIC_ECD_nAChR_proto_alpha-like 44..263 CDD:349832 101/221 (46%)
LIC 47..544 CDD:273305 196/500 (39%)
CHRNB3NP_000740.1 Neur_chan_LBD 23..449 CDD:332142 200/513 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 251 1.000 Domainoid score I2107
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45250
OrthoDB 1 1.010 - - D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.