DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha2 and chrng

DIOPT Version :9

Sequence 1:NP_524482.1 Gene:nAChRalpha2 / 42919 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001241879.1 Gene:chrng / 100536659 ZFINID:ZDB-GENE-030131-3805 Length:540 Species:Danio rerio


Alignment Length:553 Identity:178/553 - (32%)
Similarity:285/553 - (51%) Gaps:65/553 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IWRHCKPLCLLLVLLLLCETVQANPDAKRLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLID 83
            ||        |.:||........|.:.. |:.||:..||:.||||.::.|.:.||:.:.|:.||.
Zfish    10 IW--------LWILLFRFSGALCNLEGS-LHRDLMVGYNKNIRPVESHEDIIDVKIKMTLTNLIS 65

  Fly    84 LNLKDQILTTNVWLEHEWQDHKFKWDP----SEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVT 144
            ||.|::.|||.||:|.:|:|::.:|..    ..|..:|.:.:||:.||||||.|.||.||.:.|.
Zfish    66 LNEKEETLTTCVWIEMQWRDYRLRWANRTGFEVYENITRMRLPSKTIWLPDIGLENNVDGRFEVA 130

  Fly   145 TMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKD 209
            .....::...|.|.|.||||::|||.|.|.|||||.|.|.|.|.|.||:.::|.|    ..:|:|
Zfish   131 LYANTLIDPDGSVYWLPPAIYRSSCAIKVNYFPFDWQNCSMVFRSQTYNSNEITL----MLSDED 191

  Fly   210 NKVE--IGIDLREYYPSVEWDILGVPAER--HEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLII 270
            |...  |.||...:..:.||.|...||::  :::|.|...| :.:|.|.:.::||.|||.:|:|:
Zfish   192 NVTMEWIEIDPEAFTENGEWMIKHRPAKKVINKRYRPDELE-HQEIIFFLIIQRKPLFYVINIIV 255

  Fly   271 PCVGISYLSVLVFYLPADS-GEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLL 334
            |||..|.|.:||::|||.: |:|..:.|.|||.||:|..||::.:|.||.|:||:||||:|.|.:
Zfish   256 PCVLFSSLGLLVYFLPAKAGGQKCTMTICILLGQTVFLFLIAKKVPETSQAVPLIGKYLMFVMSV 320

  Fly   335 VGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRV----PKDLLRDLAANKINYGL 395
            ..::|:..:::||:..|.|:||.|...||...:..||::|.|.:    |:....|.....:..|.
Zfish   321 TTITVMNCVVVLNVSLRTPNTHPMSNTIRKVLLNILPRVLRMTMQRWTPEQEEGDFKMFALGNGT 385

  Fly   396 KFSKTKFGQ----ALMDEMQMNSGGSSPDSLRRMQGRVGAGGCNGMHVTTATNRFSGLVGALGGG 456
            ...:.:...    |..||....:..|.. ...|::.|.|          ...|....:...||| 
Zfish   386 PLRRRRRSSLGLIAKADEYMFRTARSEL-MFSRLKERKG----------LLKNTLEKIQNGLGG- 438

  Fly   457 LSTLSGYNGLPSVLSGLDDSLSDVAARKKYPFELEKAIHNVMFIQHHMQRQDEFNAEDQDWGFVA 521
                       :....|:.||:..:.      |:::.:.:...|....:.|::|.:::::|..||
Zfish   439 -----------NTAQDLECSLAAASP------EVQQCVSSCKHIAESTKHQNDFQSKNEEWFLVA 486

  Fly   522 MVMDRLFLWLFMIASLVGTFVI-----LGEAPS 549
            .|:||:..::..:..::||..|     ..:|||
Zfish   487 RVIDRMCFFVMALLFILGTIGIFLTGHFNQAPS 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha2NP_524482.1 LGIC_ECD_nAChR_proto_alpha-like 44..263 CDD:349832 87/226 (38%)
LIC 47..544 CDD:273305 169/518 (33%)
chrngNP_001241879.1 LIC 21..511 CDD:273305 170/524 (32%)
Neur_chan_LBD 27..246 CDD:280998 86/224 (38%)
Neur_chan_memb 253..509 CDD:280999 77/284 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.