DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha2 and si:ch211-256e16.4

DIOPT Version :9

Sequence 1:NP_524482.1 Gene:nAChRalpha2 / 42919 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_017210328.1 Gene:si:ch211-256e16.4 / 100333796 ZFINID:ZDB-GENE-131121-267 Length:179 Species:Danio rerio


Alignment Length:99 Identity:29/99 - (29%)
Similarity:63/99 - (63%) Gaps:1/99 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 YPD-IFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLIS 311
            |.| :.:.||::|:.|.:.:|:|:|......|.|..:::..|..:|::..:::||:.::..|:::
Zfish     4 YADQLIYQITIKRRPLLHVINIILPVFFFLVLDVTSYFIDTDGADKLSFKVTLLLAISVLLLILN 68

  Fly   312 EIIPSTSLALPLLGKYLLFTMLLVGLSVVITIII 345
            :.:|||:..|||:|.|......|:|:|::.||::
Zfish    69 DTLPSTTYELPLIGIYCSAIFSLIGISILETILV 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha2NP_524482.1 LGIC_ECD_nAChR_proto_alpha-like 44..263 CDD:349832 5/15 (33%)
LIC 47..544 CDD:273305 29/99 (29%)
si:ch211-256e16.4XP_017210328.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.