DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha2 and chrnb1l

DIOPT Version :9

Sequence 1:NP_524482.1 Gene:nAChRalpha2 / 42919 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001233249.1 Gene:chrnb1l / 100005295 ZFINID:ZDB-GENE-060811-1 Length:486 Species:Danio rerio


Alignment Length:523 Identity:176/523 - (33%)
Similarity:283/523 - (54%) Gaps:69/523 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QANPDAKRLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDH 104
            :|:...:||.:||..:||..:||.....:.|:|::|:.|.|||.||.|:..:||||::..||.|:
Zfish    15 KASEAERRLLEDLFQDYNLKVRPARTWNERVMVRVGMTLVQLISLNQKNGEMTTNVFMNMEWTDY 79

  Fly   105 KFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSC 169
            :..|:|.:|..:..:.:|...:|.|||.|.||.||::.|......::...|.|.|.||||::|||
Zfish    80 RLSWNPEDYDKIDVVRIPPVKVWRPDIYLINNNDGQFDVALYVNVLVRSDGTVSWLPPAIYRSSC 144

  Fly   170 EIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPA 234
            .|:|.|||||.|.|.|.|.|:|||..::||:: ....|.:...||.||...:..:.||.|...|:
Zfish   145 SIEVAYFPFDWQNCSMVFRSYTYDSSEVDLQY-GLDEDGNELHEIVIDENAFTENGEWQICHKPS 208

  Fly   235 ERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISI 299
            .::.:     .:.|.||.|.:.:.||.|||.:|:|:||:..|.|::.|||||..:|||:.|.||:
Zfish   209 RKNVQ-----DDLYEDITFYLIIERKPLFYVINIIVPCILTSVLAIFVFYLPPGAGEKMTLSISV 268

  Fly   300 LLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRS 364
            |::.|:|.||:::.:|.||||:|::..|::|||:||..||::::::||:|:|.||||.|..|:|.
Zfish   269 LIALTVFMLLLADKVPETSLAIPIIVNYVMFTMILVTFSVILSVVVLNLHHRTPSTHHMPGWVRK 333

  Fly   365 FFIKRLPKLL--LMRVPKDLLRDLAANKINYG-----LKFSKTKFGQALMDEMQMNSGGSSPDSL 422
            .||..||:.|  |...|::.:.:.....:..|     |:.....|.:.:..|:.|...||..:|.
Zfish   334 VFINLLPRYLGVLRPTPEEPVEEEPKENVPMGCLGNSLRPGGEYFIRKINPELVMPWRGSHNEST 398

  Fly   423 RRMQGRVGAGGCNGMHVTTATNRFSGLVGALGGGLSTLSGYNGLPSVLSGLDDSLSDVAARKKY- 486
            .::|                  |||.                             ||     .| 
Zfish   399 VKLQ------------------RFSN-----------------------------SD-----NYC 411

  Fly   487 ---PFELEKAIHNVMFIQHHMQRQDEFNAEDQDWGFVAMVMDRLFLWLFMIASLVGTFVILGEAP 548
               |..|:.||..:.::...:::||..:....||.::|:|:||||||||::.:.:||..:..:|.
Zfish   412 LILPPNLKSAIAAITYMSEQLKKQDVDDTMTDDWQYIAVVLDRLFLWLFVVITTLGTLTMFLDAS 476

  Fly   549 SLY 551
            ..|
Zfish   477 FNY 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha2NP_524482.1 LGIC_ECD_nAChR_proto_alpha-like 44..263 CDD:349832 81/218 (37%)
LIC 47..544 CDD:273305 173/507 (34%)
chrnb1lNP_001233249.1 LIC 11..473 CDD:273305 174/515 (34%)
Neur_chan_LBD 20..230 CDD:280998 80/215 (37%)
Neur_chan_memb 237..472 CDD:280999 88/286 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.