DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha1 and pHCl-2

DIOPT Version :9

Sequence 1:NP_001262916.1 Gene:nAChRalpha1 / 42918 FlyBaseID:FBgn0000036 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001303470.1 Gene:pHCl-2 / 43703 FlyBaseID:FBgn0039840 Length:526 Species:Drosophila melanogaster


Alignment Length:341 Identity:77/341 - (22%)
Similarity:143/341 - (41%) Gaps:69/341 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LANPDAKRLYDDLLS------NYNRLIRPVGNNSDRLTVKMGL--RLSQLIDVNLKNQIM--TTN 74
            |.|.::..|. :||:      .|:|::.||.:|.|...|.|.:  |....:..||.:..:  |..
  Fly    64 LKNAESMALM-ELLTRLTAPCRYDRMVPPVVHNKDGEEVPMDIYARFYIYVMKNLDSSDLQFTVQ 127

  Fly    75 VWVEQEWNDYKLKWNPDDYGGVDTLHVPSEH------------IWLPDIVLYNNADGNYEVTIMT 127
            ..::..:.|.:|.::.         ::|:..            :|:|.|.|.|.   .....:.|
  Fly   128 GLLQLRYLDPRLAFSS---------YLPNRRQPIMGESELKKMLWVPHIFLTNE---QASTVLGT 180

  Fly   128 KA-----ILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTAD 187
            .|     .::..|.|:.........:|.::.:.||||||.|.....||.|:..:|.|..  :|.:
  Fly   181 SAKDELTSIYPNGTVLTSTRLQATLYCWMNFQKFPFDEQKCKTTLESWMYNTTLVQLHW--ETDN 243

  Fly   188 SDNIEVGIDLQDYYI--SVEWDIMRVPAVRNEKFYS--CCEEPYLDIVFNLTLRRKTLFYTVNLI 248
            ..:.:..:.|.:|.:  |:..:.:|   |.||.:.|  ..|..|..|.|.:.|.|:..:|.::..
  Fly   244 PVSFDKQLQLTEYNLIGSLYNESIR---VSNESYMSHGSLEGNYSIISFTVLLTREVGYYVIDYF 305

  Fly   249 IPCVGISFLSVLVFYLPSD-SGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMM 312
            :|.:.|..:|.:.|:|.:| :..:.:|..:.|||.               :|:.|..:..|..:.
  Fly   306 LPSIMIVTISWVSFWLQADQTPARTTLGCTTLLSF---------------ITLSLSQENNLMKVS 355

  Fly   313 LVTLS----VVVTIAV 324
            .||:|    :|.||.:
  Fly   356 YVTMSEVWFLVCTIFI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha1NP_001262916.1 Neur_chan_LBD 25..240 CDD:280998 55/245 (22%)
LIC 27..530 CDD:273305 75/334 (22%)
Neur_chan_memb 247..530 CDD:280999 19/83 (23%)
pHCl-2NP_001303470.1 LIC 46..522 CDD:273305 77/341 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.