DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha1 and ZACN

DIOPT Version :9

Sequence 1:NP_001262916.1 Gene:nAChRalpha1 / 42918 FlyBaseID:FBgn0000036 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_851321.2 Gene:ZACN / 353174 HGNCID:29504 Length:412 Species:Homo sapiens


Alignment Length:343 Identity:68/343 - (19%)
Similarity:131/343 - (38%) Gaps:73/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLP 109
            |.|..|.|.:.:.:|.:.:|::....|::.:.:...|.|.:|.||...:.. ..:.:|.|.:|.|
Human    55 NGSAPLLVDVRVFVSNVFNVDILRYTMSSMLLLRLSWLDTRLAWNTSAHPR-HAITLPWESLWTP 118

  Fly   110 DIVLYN---------------NADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFD 159
            .:.:..               :.||:.::.:   |:...|.             |..::.:||.|
Human   119 RLTILEALWVDWRDQSPQARVDQDGHVKLNL---ALATETN-------------CNFELLHFPRD 167

  Fly   160 EQTCFMKFGSWTYDGYMVDLRHLKQTADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCE 224
            ...|.:.|       |.:           .|..:.::.|.:.::....:.|...|.:.|    .:
Human   168 HSNCSLSF-------YAL-----------SNTAMELEFQAHVVNEIVSVKREYVVYDLK----TQ 210

  Fly   225 EPYLDIV--FNLTLRRK--TLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVF 285
            .|...:|  |.:|||.|  .|...:.|::|...:....|....||..:.|:|...:::|||..|.
Human   211 VPPQQLVPCFQVTLRLKNTALKSIIALLVPAEALLLADVCGGLLPLRAIERIGYKVTLLLSYLVL 275

  Fly   286 FLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQRLFIQILP 350
            ...|.:.:|.:|...|||..|....::|:.||.:.|:.:..:..|..:..:..|           
Human   276 HSSLVQALPSSSSCNPLLIYYFTILLLLLFLSTIETVLLAGLLARGNLGAKSGP----------- 329

  Fly   351 KLLCIERPKKEEPEEDQP 368
                ...|:.|:.|...|
Human   330 ----SPAPRGEQREHGNP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha1NP_001262916.1 Neur_chan_LBD 25..240 CDD:280998 39/213 (18%)
LIC 27..530 CDD:273305 68/343 (20%)
Neur_chan_memb 247..530 CDD:280999 28/122 (23%)
ZACNNP_851321.2 LIC 11..368 CDD:273305 68/343 (20%)
Neur_chan_LBD 54..>187 CDD:280998 28/166 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..360 5/31 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.