DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha1 and Lcch3

DIOPT Version :9

Sequence 1:NP_001262916.1 Gene:nAChRalpha1 / 42918 FlyBaseID:FBgn0000036 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_996469.1 Gene:Lcch3 / 32554 FlyBaseID:FBgn0010240 Length:496 Species:Drosophila melanogaster


Alignment Length:338 Identity:74/338 - (21%)
Similarity:140/338 - (41%) Gaps:54/338 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GGLANPDAKRLYDDLLSNYNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWN 82
            |.|.|  ..:...::|..|:..:|| ....:.|.|.|.|.::....::..|...|..:::.|.|.
  Fly    35 GRLEN--VTQTISNILQGYDIRLRP-NFGGEPLHVGMDLTIASFDAISEVNMDYTITMYLNQYWR 96

  Fly    83 DYKLKWN--------PDDYGGVDTLHVP---SEHIWLPDIVLYNNADGN---YEVTIMTKAI-LH 132
            |.:|.:|        .:|.|..|.|.:.   :|.||:||....|  |.|   ::||...|.: |.
  Fly    97 DERLAFNIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFAN--DKNSFLHDVTERNKLVRLG 159

  Fly   133 HTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVD--LRHLKQT-----ADSDN 190
            ..|.|.:.........|.:|:.|:|.|.|.|.::..|:   ||.|.  :.:.|.|     .|::.
  Fly   160 GDGAVTYGMRFTTTLACMMDLHYYPLDSQNCTVEIESY---GYTVSDVVMYWKPTPVRGVEDAEL 221

  Fly   191 IE---VGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCV 252
            .:   :|.:..|               |.|:.   ....|..:..:..|:|...::.....:|.:
  Fly   222 PQFTIIGYETND---------------RKERL---ATGVYQRLSLSFKLQRNIGYFVFQTYLPSI 268

  Fly   253 GISFLSVLVFYLPSD-SGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTL 316
            .|..||.:.|::..: :..:::|.|:.:|::|.....:...:|..|. |..:..||:...:.| .
  Fly   269 LIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISY-VKAIDIYLVMCFVFV-F 331

  Fly   317 SVVVTIAVLNVNF 329
            :.::..|.:|..:
  Fly   332 AALLEYAAVNYTY 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha1NP_001262916.1 Neur_chan_LBD 25..240 CDD:280998 54/239 (23%)
LIC 27..530 CDD:273305 71/329 (22%)
Neur_chan_memb 247..530 CDD:280999 17/84 (20%)
Lcch3NP_996469.1 LIC 15..493 CDD:273305 74/338 (22%)
Neur_chan_LBD 47..256 CDD:280998 54/232 (23%)
Neur_chan_memb 263..490 CDD:280999 17/84 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.