DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha1 and CG8916

DIOPT Version :9

Sequence 1:NP_001262916.1 Gene:nAChRalpha1 / 42918 FlyBaseID:FBgn0000036 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_573090.3 Gene:CG8916 / 32553 FlyBaseID:FBgn0030707 Length:612 Species:Drosophila melanogaster


Alignment Length:399 Identity:84/399 - (21%)
Similarity:162/399 - (40%) Gaps:64/399 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ATGGLANPDAKRLYDDLLSNYNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQE 80
            |...:.:.:...:.::||..|.:...|.........|:..:.:..:..|:..:...:.:.:..|.
  Fly    99 AAADMLSRNISMILENLLKRYEQSQLPTHGQGVPTVVQTNILIRSMGPVSELDMDYSMDCYFRQY 163

  Fly    81 WNDYKLKWNPDDYGGVDTLHVP---SEHIWLPDIVLYNNADGN-YEVTIMTKAI-LHHTGKVVWK 140
            |.|.:|.:.    |.:.:|.:.   .:.||.||...||..... :.:|:..|.: |...|.:::.
  Fly   164 WRDKRLSFK----GPIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQNGGILYS 224

  Fly   141 PPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADSDNIEVGIDLQDYYISVE 205
            .....|:.|.::::.||.|.|:|.:..||:.|....: :...|...|:.:...|:.|.      :
  Fly   225 MRLTIKATCPMELQNFPMDRQSCPLVIGSYGYINQQL-IYEWKNQDDAVSFVPGMTLN------Q 282

  Fly   206 WDIMRV-----PAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLP 265
            :|::.:     ..||.|..:|     .|.:.||  |:|.|.::.:.:.:||:.|..||.:.|::.
  Fly   283 FDLISMMHRNFTTVRREGDFS-----VLHVAFN--LKRHTGYFLIQVYVPCILIVVLSWVSFWIH 340

  Fly   266 SD-SGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNF 329
            .: :.:::|||::.:|:|:...|.....:|..        ||.......:.:|.:..||.| :.|
  Fly   341 REATSDRVSLCVTSVLTLSTISLDSRTDLPKV--------KYATALDWFLLMSFLYCIATL-LEF 396

  Fly   330 RSPVTHRMAPWVQRLFIQILPKLLCIERPKKEEPEE---------DQPPEVLTDVYHLPPDVDKF 385
            ..              :....||...|.|:.|:..|         |...||..|.   ..|.|.|
  Fly   397 AG--------------VHYFTKLGSGESPQLEDQWEDICIANSLSDHAGEVDGDG---EADADPF 444

  Fly   386 VNYDSKRFS 394
            .:.||...|
  Fly   445 ADEDSSNGS 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha1NP_001262916.1 Neur_chan_LBD 25..240 CDD:280998 46/224 (21%)
LIC 27..530 CDD:273305 83/388 (21%)
Neur_chan_memb 247..530 CDD:280999 36/158 (23%)
CG8916NP_573090.3 LIC 92..598 CDD:273305 84/399 (21%)
Neur_chan_LBD 111..315 CDD:280998 46/221 (21%)
Neur_chan_memb 322..>403 CDD:280999 20/103 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.