DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha1 and si:ch211-256e16.4

DIOPT Version :9

Sequence 1:NP_001262916.1 Gene:nAChRalpha1 / 42918 FlyBaseID:FBgn0000036 Length:597 Species:Drosophila melanogaster
Sequence 2:XP_017210328.1 Gene:si:ch211-256e16.4 / 100333796 ZFINID:ZDB-GENE-131121-267 Length:179 Species:Danio rerio


Alignment Length:104 Identity:31/104 - (29%)
Similarity:64/104 - (61%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 YLD-IVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLA 290
            |.| :::.:|::|:.|.:.:|:|:|......|.|..:::.:|..:|:|..:::||:::|..|:|.
Zfish     4 YADQLIYQITIKRRPLLHVINIILPVFFFLVLDVTSYFIDTDGADKLSFKVTLLLAISVLLLILN 68

  Fly   291 EIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNF 329
            :.:|.|:..:||:|.|......|:.:|::.||.   |||
Zfish    69 DTLPSTTYELPLIGIYCSAIFSLIGISILETIL---VNF 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha1NP_001262916.1 Neur_chan_LBD 25..240 CDD:280998 4/13 (31%)
LIC 27..530 CDD:273305 31/104 (30%)
Neur_chan_memb 247..530 CDD:280999 25/83 (30%)
si:ch211-256e16.4XP_017210328.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.