DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13616 and CG34428

DIOPT Version :9

Sequence 1:NP_651262.1 Gene:CG13616 / 42917 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 / 5740867 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster


Alignment Length:250 Identity:62/250 - (24%)
Similarity:93/250 - (37%) Gaps:75/250 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLALCLLLHEVQSQVM-SMSSAANRTGEVTKVLRRHKR-------YLAFPEGSSVSGAVCMTIGM 67
            :|..|||.     ||| |:.|           |.:|:|       :|.:|   :.|....|.||.
  Fly     8 ILVSCLLY-----QVMASLGS-----------LFKHQRSKRAPIPWLIYP---TTSPTRVMFIGG 53

  Fly    68 IGNPDVDYLSWAVNWG----VAYDLPNHQWVIQHAHGLNAT------------------------ 104
            ||.|..|....||..|    |.|.||.....::....|..|                        
  Fly    54 IGIPLEDLNYEAVTTGYVLKVEYWLPTTPDDLRTPTALPLTQVATPGVTGARKQRKPMFENFLVG 118

  Fly   105 ---LAKDTIKRRSRR---------AFYDEVQSLFDNMGFNGRSCVARALCESAKFMLPSVERGNM 157
               |.|:|.|..:|.         ..|..::.|.|.:|:.||.||.:::||:|:  .|......:
  Fly   119 VDELGKNTRKLLTRTNKVLSSYRWTVYKGLEGLADRLGYQGRICVLKSICEAAE--EPFHYTNGL 181

  Fly   158 LQELVRTVFSLPPSPVAAHEPQAHHQYDRIYRRSK--RSSRDCHEIYPGCQFSLL 210
            ..:|:..:.: |.|.|......|.::|   |...|  :|...|..::..|:.|||
  Fly   182 FADLLHILLT-PSSSVDKLSEHADNEY---YYAEKMGQSGAGCDRVFKECRRSLL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 27/111 (24%)
CG34428NP_001097597.2 DM4_12 139..234 CDD:214785 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.