DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13616 and CG34442

DIOPT Version :9

Sequence 1:NP_651262.1 Gene:CG13616 / 42917 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 / 5740603 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster


Alignment Length:170 Identity:39/170 - (22%)
Similarity:59/170 - (34%) Gaps:32/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YLAFP-EGSSVSGAVCMTIGMIGNPDVDYLSWAVNWGVAYDLPNHQWVIQHAHGLNATLAKDTIK 111
            ||.:| .|....|..|.          :...|.:...:.....|:          |:|.|....|
  Fly    84 YLTYPTTGREAEGRHCQ----------NCTDWKIEGNINSTSSNN----------NSTKAASREK 128

  Fly   112 R----RSRRAFYDEVQSLFDNMGFNGRSCVARALCESAKFMLPSVERGNMLQELVRTVFSLPPSP 172
            |    .||..||..::......||....|:.|.:|::....|..|  ...|..||..:|| |.|.
  Fly   129 RGLTLMSRSVFYAMLRDKLRRSGFPAEPCLLRLICDTNASQLGEV--NGFLGSLVHIIFS-PSSS 190

  Fly   173 VAAHEPQAHHQYDRIYRRSKRSSRDCHEIYPGCQFSLLAL 212
            ...|.|..::|.:    ...|..::|......|..::|.|
  Fly   191 KDEHLPNEYYQAE----WDGREQQECSTYTKSCDHNILDL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 27/105 (26%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:285126 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.