DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13616 and CG17780

DIOPT Version :9

Sequence 1:NP_651262.1 Gene:CG13616 / 42917 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:238 Identity:48/238 - (20%)
Similarity:85/238 - (35%) Gaps:100/238 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HFSLLALCLLLH-------------------------------EVQSQVMSMSSA-------ANR 34
            |.|.||| |:||                               ...|.::|.|::       .:.
  Fly     3 HLSALAL-LMLHLLLVVPIPASNPPVTQPQPVDNFEGLSPLSKHFDSHMVSPSTSNIPSSDFDSA 66

  Fly    35 TGEVTKVLRRHKRYLAFPEGSSVSGAVCMTIGMIGNPDVDYLSWAVNWGVAYDLPNHQWVIQ--- 96
            :|..|::|||.||||.|.:||.                   :||..|.      .|:.|.|.   
  Fly    67 SGNSTRILRRGKRYLQFSKGSR-------------------MSWRTNG------KNNLWTINTLY 106

  Fly    97 -HAHGLNATLAKDTIK----------RRSRRAFYDEVQSLFDNMGFNGRSCVARALCESAKFMLP 150
             :.:|..|.....:|:          |..:|..:.::::..|..||:||:|:.::.|.:...:..
  Fly   107 AYGYGFRANYPFPSIEEQKKDNAVFFRLFKRDLFSKLETALDGHGFDGRACMLKSFCTAINDVDN 171

  Fly   151 SVERGNMLQELVRTVFSLPPSPVAAHEPQAHHQYDRIYRRSKR 193
            ..::..||.::::.:|                      ||:||
  Fly   172 PKQKSGMLFKMLKLIF----------------------RRAKR 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 17/94 (18%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 11/73 (15%)
DM4_12 253..338 CDD:214785
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.