DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13616 and CG7201

DIOPT Version :9

Sequence 1:NP_651262.1 Gene:CG13616 / 42917 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001261574.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster


Alignment Length:244 Identity:45/244 - (18%)
Similarity:80/244 - (32%) Gaps:78/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LAFPEGSSVSGAVCMTIGMIGNP----------------DVDYLSWAVNWGVAYDLP-------- 89
            ||.|.|:|::....:.:.::.:|                |.|.|....|.....|||        
  Fly    80 LALPPGTSLTFVPTIAMPLVRHPPEGFFSNLTISFPVTIDFDKLGLTDNQNPLGDLPPLFARSFG 144

  Fly    90 ---NH---QWVIQHAHGLNATLAKDTIKRRSRR-------------------------------- 116
               .|   ::|.::.|....  .:|..::|||.                                
  Fly   145 HEAGHMVGEYVARYLHVQRR--KRDLSEQRSRSNEDHPFRIHEEGPKYPELPAGLQHIFHGGERV 207

  Fly   117 AFYDEVQSLFDNMGFNGRSCVARALCESAKFMLPSVERGNMLQELVRTVFSLPPSPVAAHEP--- 178
            ..|..|:......|.:|::|:.|.:||...   .|:|:..:..|:.:...::..||.:...|   
  Fly   208 LLYGVVEDFLSTFGMDGKACLLRTICEMHS---RSLEKFGVFGEMTKLFLTVTKSPFSDLVPDYV 269

  Fly   179 QAHHQYDRIYRRSKRSSRDCHEIYPGCQFSLLALALGKY---MAATTTK 224
            ||..     ....|::..:|...:..|..|:......||   ..|:.||
  Fly   270 QAQE-----VGEGKQAPGECFPYFKDCPKSIFKALSSKYSKPAPASKTK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 23/136 (17%)
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 20/104 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.