DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13616 and CG33342

DIOPT Version :9

Sequence 1:NP_651262.1 Gene:CG13616 / 42917 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster


Alignment Length:199 Identity:46/199 - (23%)
Similarity:77/199 - (38%) Gaps:33/199 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VMSMSSAA---NRTGEVTKVLRRHKRYLAFPEGSSVSGAVCMTIGMIGNPDVDYLSWA-VNWGVA 85
            |::.|:|.   :|.......|.|.|| ||...|...:..|......|...|.....|. ||:...
  Fly    20 VLAASAAGDGNDRNASPGLSLSRTKR-LAIFNGQGTNKIVAGLAFPIKQADTVQSVWGFVNYQAQ 83

  Fly    86 Y---DLPNHQWVIQHAHGLNATLAKDTIKRRSRRAF--------YDEVQSLFDNMG-FNGRSCVA 138
            |   .:|.:.|...:.....:| |::..|....|.|        ||.|::..:.:| .|..:|:.
  Fly    84 YVPSPVPIYWWSFWNTSTFLST-AREWRKGIRSRVFQDETRVWLYDVVETGLERLGDRNAGACLL 147

  Fly   139 RALCESAK--FMLPSVERGNMLQELVRTVFSLPPSPVAAHEPQAHHQYDRIYRRSKRSSRDCHEI 201
            :.:||.::  ||     ..::..|::..|  |.||.....|...|      .|.:.::..:|.:.
  Fly   148 KCICEISQRPFM-----HNSIFGEILNAV--LVPSLDNVPEKYLH------ARNAGKAGANCRKT 199

  Fly   202 YPGC 205
            |..|
  Fly   200 YSDC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 24/107 (22%)
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.