DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5768 and CG34428

DIOPT Version :9

Sequence 1:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 / 5740867 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster


Alignment Length:223 Identity:49/223 - (21%)
Similarity:73/223 - (32%) Gaps:81/223 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 HRRWQRALSRPKRYLSFPEGSSFSVAVCFTVGIIGNPYYGYNSFGLNWG----VAYDLPNT---- 264
            |:|.:||   |..:|.:|..|...|   ..:|.||.|....|...:..|    |.|.||.|    
  Fly    27 HQRSKRA---PIPWLIYPTTSPTRV---MFIGGIGIPLEDLNYEAVTTGYVLKVEYWLPTTPDDL 85

  Fly   265 -TWVLQHLHGFATHPVAPAVLRRRS------------------------------RSAIYRQIEA 298
             |.....|...||..|..|..:|:.                              |..:|:.:|.
  Fly    86 RTPTALPLTQVATPGVTGARKQRKPMFENFLVGVDELGKNTRKLLTRTNKVLSSYRWTVYKGLEG 150

  Fly   299 VVDNMGYNGRDCILRTLCES----------------------------------RQYFQRTKMSM 329
            :.|.:||.||.|:|:::||:                                  .:|:...||..
  Fly   151 LADRLGYQGRICVLKSICEAAEEPFHYTNGLFADLLHILLTPSSSVDKLSEHADNEYYYAEKMGQ 215

  Fly   330 VGEMLRTIFSLPKQRIFTR--ELHENAD 355
            .|.....:|...::.:...  |||.|.|
  Fly   216 SGAGCDRVFKECRRSLLQHFSELHHNLD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 23/136 (17%)
CG34428NP_001097597.2 DM4_12 139..234 CDD:214785 17/94 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.