DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5768 and CG34444

DIOPT Version :9

Sequence 1:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster


Alignment Length:139 Identity:35/139 - (25%)
Similarity:55/139 - (39%) Gaps:36/139 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 GFATHPVAPAVLR-RRSRSAIYRQIEAVVDNMGYN------GRDCILRTLCESRQYFQRTKMSMV 330
            ||....:..:|.| |:|||.:.|.....:.|..:.      |..|:||.:||:..|.......::
  Fly   171 GFPLDGMGESVGRDRQSRSLLSRTKFYYIINHRFELHGLGAGDSCLLRLICEANSYQLGDLNGVL 235

  Fly   331 GEMLRTIFS--------LPKQRIFTRELHENADIVHYDQAYRNAHTDDCTQY--NCHFSLLELAF 385
            |.::..:||        ||| |.:..||              :....:|..|  .|..|:|::  
  Fly   236 GSLIHVMFSPSSSRYEELPK-RYYIAEL--------------DGRNGNCGGYRVQCEHSVLDM-- 283

  Fly   386 GKYTTPPKN 394
              .|.|.||
  Fly   284 --ITQPVKN 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 27/112 (24%)
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 20/97 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.