DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5768 and CG13616

DIOPT Version :9

Sequence 1:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_651262.1 Gene:CG13616 / 42917 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster


Alignment Length:183 Identity:88/183 - (48%)
Similarity:119/183 - (65%) Gaps:12/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 RALSRPKRYLSFPEGSSFSVAVCFTVGIIGNPYYGYNSFGLNWGVAYDLPNTTWVLQHLHGF-AT 276
            :.|.|.||||:||||||.|.|||.|:|:||||...|.|:.:||||||||||..||:||.||. ||
  Fly    40 KVLRRHKRYLAFPEGSSVSGAVCMTIGMIGNPDVDYLSWAVNWGVAYDLPNHQWVIQHAHGLNAT 104

  Fly   277 HPVAPAVLRRRSRSAIYRQIEAVVDNMGYNGRDCILRTLCESRQYFQRT--KMSMVGEMLRTIFS 339
              :|...::||||.|.|.:::::.||||:|||.|:.|.||||.::...:  :.:|:.|::||:||
  Fly   105 --LAKDTIKRRSRRAFYDEVQSLFDNMGFNGRSCVARALCESAKFMLPSVERGNMLQELVRTVFS 167

  Fly   340 LPKQRIFTRELHENADIVHYDQAYRNA--HTDDCTQY--NCHFSLLELAFGKY 388
            ||...:   ..||......||:.||.:  .:.||.:.  .|.||||.||.|||
  Fly   168 LPPSPV---AAHEPQAHHQYDRIYRRSKRSSRDCHEIYPGCQFSLLALALGKY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 40/102 (39%)
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 40/104 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.