DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5768 and CG17780

DIOPT Version :9

Sequence 1:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:385 Identity:90/385 - (23%)
Similarity:150/385 - (38%) Gaps:90/385 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PPATSHEAGKVNNVT-LTP-----PGHSVVAQGN---AQDFDRDLDQDPLTPHAAPSSQRKLSRG 83
            ||.|..:  .|:|.. |:|     ..|.|....:   :.|||          .|:.:|.|.|.||
  Fly    25 PPVTQPQ--PVDNFEGLSPLSKHFDSHMVSPSTSNIPSSDFD----------SASGNSTRILRRG 77

  Fly    84 KRFVAFPQGSSASGAVCLTTGV--IGNPNLLYLSLGINWGVAYDLPNVTWVLQNAHGWTTKKSAQ 146
            ||::.|.:||..|..   |.|.  :...|.|| :.|..:...|..|::          ..:|...
  Fly    78 KRYLQFSKGSRMSWR---TNGKNNLWTINTLY-AYGYGFRANYPFPSI----------EEQKKDN 128

  Fly   147 AQIKRRHRRELYGRLETMIDSRDLWSPPTLMTMMERADDSTA----STSTFASSPESLVTSSHLL 207
            |...|..:|:|:.:|||.:|....              |..|    |..|..:..::....|.:|
  Fly   129 AVFFRLFKRDLFSKLETALDGHGF--------------DGRACMLKSFCTAINDVDNPKQKSGML 179

  Fly   208 HRRWQRALSRPKRYLSFPEGSSFSVAVCFTVGIIGNPYYGYNS---FGLNWGVAYDLPNTTWVLQ 269
            .:..:....|.||||...|.:...|.:   ..:|.|.|  .||   |.:|  ...::..:..|..
  Fly   180 FKMLKLIFRRAKRYLDIIETTRIFVGI---FQVIVNTY--INSPLKFRVN--AKNNVIKSPIVWA 237

  Fly   270 HLHGFATHPVAPAVLRRRS---RSAIYRQIEAVVDNMGYNGRDCILRTLCESRQYFQRTKMSMVG 331
            |.:||..:  .|.:::|.:   |...|..:..::|..|.:||.|:|:..|          .::.|
  Fly   238 HGYGFRAN--TPVLVKRENRPFRRDTYELLHELIDRSGLDGRACVLKAYC----------TALAG 290

  Fly   332 EMLR-TIFSLPKQRIFTRELHENADIVHYDQAYRNAHTDDCTQ-YNCHFSLLELAFGKYT 389
            :..: .:|.|.|. :||.:.|:...:.|..:       ::|.| .:.|..|...:...||
  Fly   291 DHGQGFLFKLLKY-VFTLDEHDKRHMPHLRE-------ENCEQIMHSHCPLSFDSISPYT 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 22/101 (22%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 12/65 (18%)
DM4_12 253..338 CDD:214785 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.