DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5768 and CG17784

DIOPT Version :9

Sequence 1:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_651254.1 Gene:CG17784 / 42909 FlyBaseID:FBgn0039192 Length:237 Species:Drosophila melanogaster


Alignment Length:209 Identity:41/209 - (19%)
Similarity:83/209 - (39%) Gaps:51/209 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LMTMMERADDSTASTSTFASSPESLVTSSHLLHRRWQ------RALSRPKRY------------- 221
            |::::...|...:.|....:|.||.:..|..::...:      .:|||.||.             
  Fly    12 LLSLLFTIDLVLSFTKNIYTSDESFLRISRSINHPDESDNSSLTSLSRSKRVAIYNGQGVVKLVP 76

  Fly   222 -LSFP-----EGSSFSVAVCFTVGIIGNPYYGYNSFGLNWGVAYDLPNTTWVLQHLHGFAT---- 276
             |::|     :..||              ::.:|..| .| :...:|...|...:...|.:    
  Fly    77 SLAYPVKQTDKEQSF--------------WWFFNLQG-QW-IPTTIPLYWWSFWNTTAFVSTARE 125

  Fly   277 --HPVAPAVLRRRSRSAIYRQIEAVVDNM-GYNGRDCILRTLCE-SRQYFQRTKMSMVGEMLRTI 337
              ..:...||...:|:.:|..||..::.: |..|..|:||::|| |::.||.:  ::..|::..:
  Fly   126 WRKDMQAKVLHDEARTWVYNAIEVGMEQLDGAYGGVCLLRSICEISQKPFQNS--NIFSEIVNAV 188

  Fly   338 FSLPKQRIFTRELH 351
            .......:.::.||
  Fly   189 LVPTLDNVASKYLH 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 17/68 (25%)
CG17784NP_651254.1 DM4_12 135..227 CDD:214785 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.