DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5768 and CG33262

DIOPT Version :9

Sequence 1:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster


Alignment Length:181 Identity:44/181 - (24%)
Similarity:74/181 - (40%) Gaps:26/181 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 SRPKRYLSFPEGSSFSVAVCFTVGIIGNPYYGYNSFGLNWGVAYDLPNTTWVLQHLHGFATHPVA 280
            ||.||:|.||..:.........:||..:..|...:.|......|.||....|      :..:|:.
  Fly    28 SRSKRFLIFPRQAPTRHQFIAGIGIPADLEYESLTVGYVLKAEYYLPYNATV------YRQNPLF 86

  Fly   281 P--------AVLRRR-------SRSAIYRQIEAVVDNMGYNGRDCILRTLCESRQYFQRTKMSMV 330
            |        |..:|:       .|..:|:.||.:::..|.||..|:|..:||:.........|..
  Fly    87 PEYKPNTIDAQDQRKLFMKPTDLRWQLYQFIEHMLNGYGLNGHACLLEAICEANNIKFAKDFSTA 151

  Fly   331 GEMLRTIFSLPKQRIFTRELHENADIVHYDQAYRNAHTDDCTQYNCHFSLL 381
            ||||..:.| |...: ..|.:...|.:   .|.::....||::|:|:..::
  Fly   152 GEMLHLLLS-PSSTL-NSESNRALDFI---LAEKDGSRRDCSKYDCNTKII 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 26/103 (25%)
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.