DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17780 and CG34442

DIOPT Version :9

Sequence 1:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 / 5740603 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster


Alignment Length:237 Identity:47/237 - (19%)
Similarity:72/237 - (30%) Gaps:80/237 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 CTAINDVDNPKQKSGMLFKMLKLIFRRAKRYLDIIETTRIFVGIFQVIV--------NTYINSPL 219
            |..||:.:  ..||.:||                  ||....|||..|.        |.:::...
  Fly    14 CAIINNFN--LVKSALLF------------------TTNSEYGIFMAISVPIGLPHRNVFLSYNY 58

  Fly   220 KFRVNAKNNVIKSPIV------------------------------W-----AHGYGFRANTPVL 249
            :|......:|.|.|.:                              |     .:......|:...
  Fly    59 EFNYYQPEHVYKYPPILMGQDFEDSYLTYPTTGREAEGRHCQNCTDWKIEGNINSTSSNNNSTKA 123

  Fly   250 VKRENRPF----RRDTYELLHELIDRSGLDGRACVLKAYCTALAGDHGQ--GFLFKLLKYVFTLD 308
            ..||.|..    |...|.:|.:.:.|||.....|:|:..|...|...|:  |||..|:..:|:..
  Fly   124 ASREKRGLTLMSRSVFYAMLRDKLRRSGFPAEPCLLRLICDTNASQLGEVNGFLGSLVHIIFSPS 188

  Fly   309 EHDKRHMPH---------LREENCEQIMHS--HCPLSFDSIS 339
            .....|:|:         ..::.|.....|  |..|...|:|
  Fly   189 SSKDEHLPNEYYQAEWDGREQQECSTYTKSCDHNILDLVSVS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 7/24 (29%)
DM4_12 253..338 CDD:214785 24/101 (24%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:285126 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.