DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17780 and CG42812

DIOPT Version :9

Sequence 1:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001097901.2 Gene:CG42812 / 50072 FlyBaseID:FBgn0261994 Length:217 Species:Drosophila melanogaster


Alignment Length:219 Identity:44/219 - (20%)
Similarity:71/219 - (32%) Gaps:101/219 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 WTINTLYAYGY------------GFRANY----PFPSIEEQKKDNAVFFRLFKRD---------- 138
            |.....|.|.|            || |||    ..|.:|...::   |:..:..|          
  Fly    53 WCFAISYNYPYNLTEFYSIPIWPGF-ANYKAKREVPQLEMTDEN---FYTKYGHDNGNGMHPKDF 113

  Fly   139 ----LFSKLETALDGHGFDGRACMLKSFCTAINDVDNPKQKSGMLFKMLKLIFRRAKRYL--DII 197
                |::.||..|.|:||. ..|:|:|.|                 ::.:..|..:.::|  ||:
  Fly   114 SAGELYAFLEDTLTGYGFH-ETCLLRSVC-----------------ELAQHPFDDSHQHLLSDIV 160

  Fly   198 ETTRIFVGIFQVIVNTYINSPLKFRVNAKNNVIKSPIVWAHGYGFRANTPVLVKRENRPFRRDTY 262
                           |::.||.:..                  |||.:             .|.|
  Fly   161 ---------------TFVLSPSQHE------------------GFRDD-------------EDVY 179

  Fly   263 ELLHELIDRSGLDGRACV-LKAYC 285
            ...:||.::.|..||.|: |.::|
  Fly   180 RKAYELAEQDGFLGRDCLRLYSHC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 12/65 (18%)
DM4_12 253..338 CDD:214785 10/34 (29%)
CG42812NP_001097901.2 DM4_12 110..210 CDD:214785 31/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.