DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17780 and CG5768

DIOPT Version :9

Sequence 1:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster


Alignment Length:385 Identity:90/385 - (23%)
Similarity:150/385 - (38%) Gaps:90/385 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PPVTQPQ--PVDNFEGLSPLSKHFDSHMVSPSTSNIPSSDFD----------SASGNSTRILRRG 77
            ||.|..:  .|:|.. |:|     ..|.|....:   :.|||          .|:.:|.|.|.||
  Fly    28 PPATSHEAGKVNNVT-LTP-----PGHSVVAQGN---AQDFDRDLDQDPLTPHAAPSSQRKLSRG 83

  Fly    78 KRYLQFSKGSRMSWR---TNGKNNLWTINTLY-AYGYGFRANYPFPSI----------EEQKKDN 128
            ||::.|.:||..|..   |.|.  :...|.|| :.|..:...|..|::          ..:|...
  Fly    84 KRFVAFPQGSSASGAVCLTTGV--IGNPNLLYLSLGINWGVAYDLPNVTWVLQNAHGWTTKKSAQ 146

  Fly   129 AVFFRLFKRDLFSKLETALDGHGF--------------DGRACMLKSFCTAINDVDNPKQKSGML 179
            |...|..:|:|:.:|||.:|....              |..|    |..|..:..::....|.:|
  Fly   147 AQIKRRHRRELYGRLETMIDSRDLWSPPTLMTMMERADDSTA----STSTFASSPESLVTSSHLL 207

  Fly   180 FKMLKLIFRRAKRYLDIIETTRIFVGI---FQVIVNTY--INSPLKFRVN--AKNNVIKSPIVWA 237
            .:..:....|.||||...|.:...|.:   ..:|.|.|  .||   |.:|  ...::..:..|..
  Fly   208 HRRWQRALSRPKRYLSFPEGSSFSVAVCFTVGIIGNPYYGYNS---FGLNWGVAYDLPNTTWVLQ 269

  Fly   238 HGYGFRAN--TPVLVKRENRPFRRDTYELLHELIDRSGLDGRACVLKAYC----------TALAG 290
            |.:||..:  .|.:::|.:   |...|..:..::|..|.:||.|:|:..|          .::.|
  Fly   270 HLHGFATHPVAPAVLRRRS---RSAIYRQIEAVVDNMGYNGRDCILRTLCESRQYFQRTKMSMVG 331

  Fly   291 DHGQGFLFKLLKY-VFTLDEHDKRHMPHLRE-------ENCEQIMHSHCPLSFDSISPYT 342
            :..: .:|.|.|. :||.:.|:...:.|..:       ::|.| .:.|..|...:...||
  Fly   332 EMLR-TIFSLPKQRIFTRELHENADIVHYDQAYRNAHTDDCTQ-YNCHFSLLELAFGKYT 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 12/65 (18%)
DM4_12 253..338 CDD:214785 21/102 (21%)
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 22/101 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.