DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17780 and CG17782

DIOPT Version :9

Sequence 1:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_651257.1 Gene:CG17782 / 42912 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster


Alignment Length:364 Identity:64/364 - (17%)
Similarity:114/364 - (31%) Gaps:162/364 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PASNPPV-TQPQPVDNFEGLSPL-SKHFDSHM------VSPSTSNIPSSDFDSASGNSTRILRRG 77
            |...||: ...:..|::....|. .:..|:|.      ||.|:||                    
  Fly   220 PVFRPPMHPSHRYADSYYSSRPKGGRRKDNHYYYSRPGVSSSSSN-------------------- 264

  Fly    78 KRYLQFSKGSR-MSWRTNGKNNLWTINT-LYAYGYGFRANYPFPSIEEQKKDNAV---------- 130
                .|:|.:| .|...|.:...|.:|: |....||:::....|...::::|:..          
  Fly   265 ----PFAKWTRPYSHAQNSRYPYWALNSRLKDRYYGYKSQQAAPPAAQRRQDSTTTTSAPTTSRP 325

  Fly   131 -------FFRLFKRDLFSKLETALDGHGFDGRACMLKSFCTAINDVDNP---KQKSGMLF----K 181
                   ..|::  .:|.|                     .:|.|..||   :::||:..    |
  Fly   326 TRRPAPRHHRIY--PVFGK---------------------RSIPDAANPHKRQRRSGVATEHEDK 367

  Fly   182 MLKLIFRRAKRYLDIIETTRIFVGIFQVIVNTYINSPLKFRVNAKNNVIKSPIVWAHGYGFRANT 246
            |.:|            |..:|                                            
  Fly   368 MSRL------------EQLQI-------------------------------------------- 376

  Fly   247 PVLVKRENRPFRRDTYELLHELIDRSGLDGRACVLKAYCTA--LAGDHGQG-FLFKLLKYVFTLD 308
                 :.:|..|:..||.:.:.:|:.|..|..|||:..|..  .:.:|..| |:.:|::.||||.
  Fly   377 -----KHHRRSRQSLYERIEKYLDKRGHHGHHCVLRTLCETGQKSTEHEPGTFVGELMRAVFTLP 436

  Fly   309 E-------------HDKRHMPHLREENCEQIMHSHCPLS 334
            |             :||   .|..:.:| .:::..|..|
  Fly   437 EAMDNEPVAYRDSHYDK---AHASKADC-AVLYPECKQS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 11/58 (19%)
DM4_12 253..338 CDD:214785 26/98 (27%)
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 26/98 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.