DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17780 and CG14115

DIOPT Version :9

Sequence 1:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster


Alignment Length:116 Identity:26/116 - (22%)
Similarity:44/116 - (37%) Gaps:42/116 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 YGFRANYPFPSIE----------------------------------EQKKDNAVFFRL------ 134
            :.|.:||..||.:                                  .|.:||.|..|.      
  Fly    54 FNFESNYALPSNDSYNQWIDRWDLDDHYLGVGGNVTPINARQDGGDFSQDEDNEVRRRSVGSPPP 118

  Fly   135 FKR-DLFSKLETALDGHGFDGRACMLKSFC-TAINDVDNPKQKSGMLFKML 183
            |:| |.:..:...|..:||:|.||:|::.| .:.:.:|:.....|.||::|
  Fly   119 FRRHDFYRSIINFLTHYGFNGSACLLRTICEVSESPLDDQNGLLGSLFQIL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 15/50 (30%)
DM4_12 253..338 CDD:214785
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.