Sequence 1: | NP_732995.1 | Gene: | CG17780 / 42914 | FlyBaseID: | FBgn0039197 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261574.1 | Gene: | CG7201 / 38929 | FlyBaseID: | FBgn0035865 | Length: | 345 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 37/196 - (18%) |
---|---|---|---|
Similarity: | 67/196 - (34%) | Gaps: | 66/196 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 PLSKHFDSHMVSPSTSNIP-SSDFDSASGNSTRILRRGKRYLQFSKGSRMSWRTNGKNNLWTINT 104
Fly 105 LYAYGYGFRANY-------PFPSIEEQKKDNAVF---------FRLFKRD--------------- 138
Fly 139 ------LFSKLETALDGHGFDGRACMLKSFCTAINDVDNPKQKSGMLFKMLKLIFRRAKR-YLDI 196
Fly 197 I 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17780 | NP_732995.1 | DM4_12 | 136..>188 | CDD:285126 | 15/72 (21%) |
DM4_12 | 253..338 | CDD:214785 | |||
CG7201 | NP_001261574.1 | DM4_12 | 201..298 | CDD:214785 | 17/68 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR21398 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |