DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17780 and CG7201

DIOPT Version :10

Sequence 1:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_648200.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster


Alignment Length:177 Identity:33/177 - (18%)
Similarity:60/177 - (33%) Gaps:56/177 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ILDSRVVNGKVEYFLKWKGYSSEENTWEPEENLDCDDLIQAFKESRKKKEGKPLN-----LSSFH 82
            ::.||:::|.:..|  |..|.:                             .|||     :.|.|
  Fly   394 MISSRLISGVLVQF--WCSYGT-----------------------------VPLNVIVTQMGSRH 427

  Fly    83 VSTAKEESSGRKS------KLKDSSEEPKAVPAKRKATSDKKVGFDRGLIPEEIIGATDEHGKLM 141
            ......||. |.|      ::|:.|:..::|.:...||.|::        .|..:|.......:.
  Fly   428 KKAVIAESV-RDSLHSWCKRVKERSKHTRSVCSLDTATIDER--------DEMTVGTLSRSSSMT 483

  Fly   142 FL--MKWKNAANADLVPAEQANVKCPQIVIKFYESRLTWQSAEAKND 186
            .|  :...:...|:.:....|:...||   ..|.||:....:|..|:
  Fly   484 SLNQITINSIDQAESIFGAAASSSSPQ---DGYTSRVEEYLSETYNN 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17780NP_732995.1 DM4_12 136..>188 CDD:462285 10/53 (19%)
DM4_12 253..338 CDD:214785
CG7201NP_648200.1 DM4_12 201..298 CDD:214785
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.