DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17780 and CG33262

DIOPT Version :10

Sequence 1:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster


Alignment Length:120 Identity:31/120 - (25%)
Similarity:45/120 - (37%) Gaps:38/120 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GYGFRANYPFPSIEEQKKDNAVFFR---LF------------KRDLFSK-----------LETAL 147
            ||..:|.|..|.       ||..:|   ||            :|.||.|           :|..|
  Fly    64 GYVLKAEYYLPY-------NATVYRQNPLFPEYKPNTIDAQDQRKLFMKPTDLRWQLYQFIEHML 121

  Fly   148 DGHGFDGRACMLKSFCTAIN-----DVDNPKQKSGMLFKMLKLIFRRAKRYLDII 197
            :|:|.:|.||:|::.|.|.|     |.....:...:|......:...:.|.||.|
  Fly   122 NGYGLNGHACLLEAICEANNIKFAKDFSTAGEMLHLLLSPSSTLNSESNRALDFI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17780NP_732995.1 DM4_12 136..>188 CDD:462285 17/67 (25%)
DM4_12 253..338 CDD:214785
CG33262NP_996071.2 DM4_12 110..192 CDD:462285 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.