DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17781 and CG34428

DIOPT Version :10

Sequence 1:NP_651258.1 Gene:CG17781 / 42913 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 / 5740867 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster


Alignment Length:106 Identity:27/106 - (25%)
Similarity:46/106 - (43%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 SSRQLLFGKIERLYKSRRLNGTSCVLRALCESSQRQQHVLRGTNAVRPQSFIMEILSAIFQLPSS 388
            |.|..::..:|.|.......|..|||:::||:::...|...|..|     .::.||     |..|
  Fly   139 SYRWTVYKGLEGLADRLGYQGRICVLKSICEAAEEPFHYTNGLFA-----DLLHIL-----LTPS 193

  Fly   389 DDVEELEELELMISPN---YLEAHRQKG-NCRQIYGDCNHT 425
            ..|::|.|    .:.|   |.|...|.| .|.:::.:|..:
  Fly   194 SSVDKLSE----HADNEYYYAEKMGQSGAGCDRVFKECRRS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 27/106 (25%)
CG34428NP_001097597.2 DM4_12 139..234 CDD:214785 27/106 (25%)

Return to query results.
Submit another query.