DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17781 and CG34428

DIOPT Version :9

Sequence 1:NP_651258.1 Gene:CG17781 / 42913 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 / 5740867 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster


Alignment Length:106 Identity:27/106 - (25%)
Similarity:46/106 - (43%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 SSRQLLFGKIERLYKSRRLNGTSCVLRALCESSQRQQHVLRGTNAVRPQSFIMEILSAIFQLPSS 388
            |.|..::..:|.|.......|..|||:::||:::...|...|..|     .::.||     |..|
  Fly   139 SYRWTVYKGLEGLADRLGYQGRICVLKSICEAAEEPFHYTNGLFA-----DLLHIL-----LTPS 193

  Fly   389 DDVEELEELELMISPN---YLEAHRQKG-NCRQIYGDCNHT 425
            ..|::|.|    .:.|   |.|...|.| .|.:::.:|..:
  Fly   194 SSVDKLSE----HADNEYYYAEKMGQSGAGCDRVFKECRRS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 27/106 (25%)
CG34428NP_001097597.2 DM4_12 139..234 CDD:214785 27/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.