DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17781 and CG34442

DIOPT Version :9

Sequence 1:NP_651258.1 Gene:CG17781 / 42913 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 / 5740603 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster


Alignment Length:184 Identity:38/184 - (20%)
Similarity:63/184 - (34%) Gaps:54/184 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 WDYAYSQRPREVLRAPP---------KHHIYPVFARRRRRR---------------------SLD 309
            :::.|.| |..|.:.||         .:..||...|....|                     :..
  Fly    58 YEFNYYQ-PEHVYKYPPILMGQDFEDSYLTYPTTGREAEGRHCQNCTDWKIEGNINSTSSNNNST 121

  Fly   310 QDAHFERLHLQQHLSSRQLLFGKIERLYKSRRLNGTSCVLRALCESSQRQQHVLRGTNAVRPQSF 374
            :.|..|:..|.  |.||.:.:..:....:........|:||.:|:::..|...:.|        |
  Fly   122 KAASREKRGLT--LMSRSVFYAMLRDKLRRSGFPAEPCLLRLICDTNASQLGEVNG--------F 176

  Fly   375 IMEILSAIFQLPSSDDVEELEELELMISPN-YLEAH---RQKGNCRQIYGDCNH 424
            :..::..||. |||...|.|        || |.:|.   |::..|......|:|
  Fly   177 LGSLVHIIFS-PSSSKDEHL--------PNEYYQAEWDGREQQECSTYTKSCDH 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 25/108 (23%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:285126 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.