DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17781 and CG34443

DIOPT Version :9

Sequence 1:NP_651258.1 Gene:CG17781 / 42913 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 / 5740580 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster


Alignment Length:255 Identity:55/255 - (21%)
Similarity:94/255 - (36%) Gaps:73/255 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 AYAANEHDSHSYYTNIQRIPAAYPYAN--ANANADANANGQQSQAAIPANWHA----RQSPAEWQ 240
            |:.|:  .:|..:..| .:|...|:.|  .:.|.:||.|       :||||..    :..|.|.:
  Fly    26 AFTAS--STHGIFAAI-AVPLELPHRNVFVSYNFEANYN-------LPANWEKWTIFQNGPIESE 80

  Fly   241 QRVKTTGADNWWTRNGQRVQ---QNWREKQRIWGPSKWDYAYSQRPREVLRAPPKHHIYPVFARR 302
            :.|..|.     |...:::.   ||...|:.       :.|.|:...|:....|         :.
  Fly    81 EVVDETD-----TETDRKLAAGCQNCTVKEE-------NEAGSEEVEEITEVLP---------QE 124

  Fly   303 RRRRSLDQDAHFERLHLQQHLSSRQLLFGKIERLYKSRRLNGTSCVLRALCESSQRQQHVLRGTN 367
            |:.|||...::..|:.              :::|.:| ...|.||:||.:||:|..|.....|  
  Fly   125 RKVRSLLTRSNIYRIF--------------VDKLKRS-GFRGESCLLRLICETSAAQLDEFNG-- 172

  Fly   368 AVRPQSFIMEILSAIFQLPSSDDVEELEELELMISPNYLEAHRQ--KGNCRQIYGDCNHT 425
                      :|.::..:..|....|.|:|.|    .|.:|...  .|:|......|..:
  Fly   173 ----------VLGSLMHVLFSPSSSESEDLPL----RYYQAEHDGWNGHCHVYEPGCGES 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 23/107 (21%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.