DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17781 and CG34184

DIOPT Version :9

Sequence 1:NP_651258.1 Gene:CG17781 / 42913 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001097310.1 Gene:CG34184 / 5740423 FlyBaseID:FBgn0085213 Length:224 Species:Drosophila melanogaster


Alignment Length:166 Identity:37/166 - (22%)
Similarity:69/166 - (41%) Gaps:43/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 WDYAYSQRPREVLRAPP---------KHHIYPV-----FARRRRRRSLDQDAHFER--LHLQQHL 323
            :::.|.| |..|.:.||         .:..|..     .:..|..||:|.::..::  |.:....
  Fly    52 YEFNYYQ-PEHVYKYPPILMGDNWEDSYLTYNTTGGDDSSSSRSFRSVDDNSSTQKRTLPIMSRT 115

  Fly   324 SSRQLLFGKIERL-YKSRRLNGTSCVLRALCESSQRQQHVLRGTNAVRPQSFIMEILSAIFQLPS 387
            :...:|..|:||. |.:.     ||:||.:||::......:.|        .:..|:..:| .||
  Fly   116 NFYIMLKDKLERSGYPAE-----SCLLRLICETNSSTLGEVNG--------LLGSIVHILF-TPS 166

  Fly   388 SDDVEELEELELMISPNYLEAHRQKGNCRQIYGDCN 423
            |.:.|.|::       :|.:|  :....|  :|||:
  Fly   167 SSNDENLDK-------DYYQA--EWDGLR--HGDCS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 25/104 (24%)
CG34184NP_001097310.1 DM4_12 114..197 CDD:285126 25/103 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.