DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17781 and CG17780

DIOPT Version :9

Sequence 1:NP_651258.1 Gene:CG17781 / 42913 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:249 Identity:46/249 - (18%)
Similarity:85/249 - (34%) Gaps:82/249 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 VPDPEPDPP---SQPLTHSQNLELDNRGADTANWQAVHAPPANPPAYAANEHDSHSYYTNIQRIP 201
            ||.|..:||   .||:.:.:.|                    :|   .:...|||....:...||
  Fly    18 VPIPASNPPVTQPQPVDNFEGL--------------------SP---LSKHFDSHMVSPSTSNIP 59

  Fly   202 AA-YPYANANANADANANGQQSQAAIPANWHARQSPAEWQQRVKTTGADNWWTRNGQRVQQNWRE 265
            :: :..|:.|:........:..|       .::.|...|    :|.|.:|.||.|          
  Fly    60 SSDFDSASGNSTRILRRGKRYLQ-------FSKGSRMSW----RTNGKNNLWTIN---------- 103

  Fly   266 KQRIWGPSKWDYAYSQRPREVLRAPPKHHIYPVFARRRRRRSLDQDAHFERLHLQQHLSSRQLLF 330
                   :.:.|.|..|..           ||..:...:::   .:|.|.||.       ::.||
  Fly   104 -------TLYAYGYGFRAN-----------YPFPSIEEQKK---DNAVFFRLF-------KRDLF 140

  Fly   331 GKIERLYKSRRLNGTSCVLRALCESSQRQQHVLRGTNAVRPQSFIMEILSAIFQ 384
            .|:|........:|.:|:|::.|.:      :....|..:....:.::|..||:
  Fly   141 SKLETALDGHGFDGRACMLKSFCTA------INDVDNPKQKSGMLFKMLKLIFR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 12/64 (19%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 11/57 (19%)
DM4_12 253..338 CDD:214785
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.