DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17781 and CG14720

DIOPT Version :9

Sequence 1:NP_651258.1 Gene:CG17781 / 42913 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster


Alignment Length:96 Identity:24/96 - (25%)
Similarity:46/96 - (47%) Gaps:14/96 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 RQLLFGKIERLYKSRRLNGTSCVLRALCESSQRQQHVLRGTNAVRPQSFIMEILSAIFQLPSS-- 388
            |.:::..||.:.::..|.|.||:||.:||      |.....|  .....:.||::.:.: |||  
  Fly   101 RWIIYRGIEMVIENMGLPGRSCLLRLICE------HAALPLN--HESGLLGEIMNIVLR-PSSSV 156

  Fly   389 DDVEELEELELMISPNYLEAHRQKGNCRQIY 419
            |.:.:..:.|...|.::   .::.|:|:..|
  Fly   157 DQLGQSSDREYHTSEHF---GKRGGDCQAAY 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 24/96 (25%)
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.