DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17781 and CG7201

DIOPT Version :9

Sequence 1:NP_651258.1 Gene:CG17781 / 42913 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001261574.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster


Alignment Length:437 Identity:80/437 - (18%)
Similarity:134/437 - (30%) Gaps:194/437 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLILLLPL------CLIQNYSAPSGNGHSNVSHTVVITPAPAPAGPLESGRDAMLRLHRQKRYLL 74
            ||:|||||      .|..|..|.:|..   :.....:..|.|.|.| :...|:....|.:|:.|:
  Fly    12 LLLLLLPLVSLCPNALALNRQADAGQA---LDMAAQLADAEAEARP-DYDADSPDTPHIRKKRLI 72

  Fly    75 F---------PEGSSFQLVFDIIIPIIDYTNYAILGITCSVAWELPSKPPSELIENVLTRINDGT 130
            :         |.|:|...|..|.:|::.:                   ||.....|:       |
  Fly    73 WITDDGRLALPPGTSLTFVPTIAMPLVRH-------------------PPEGFFSNL-------T 111

  Fly   131 IGTVRRNGSVPDPEPDPPSQPLTHSQNLELDNRG-ADTANWQAVHAPPAN-PPAYAAN-EHDS-H 191
            |                 |.|:|    ::.|..| .|..|      |..: ||.:|.: .|:: |
  Fly   112 I-----------------SFPVT----IDFDKLGLTDNQN------PLGDLPPLFARSFGHEAGH 149

  Fly   192 ------SYYTNIQRIPAAYPYANANANADANANGQQSQAAIPANWHARQSPAEWQQRVKTTGADN 250
                  :.|.::||           ...|.:....:|....|...|..                 
  Fly   150 MVGEYVARYLHVQR-----------RKRDLSEQRSRSNEDHPFRIHEE----------------- 186

  Fly   251 WWTRNGQRVQQNWREKQRIWGPSKWDYAYSQRPREVLRAPPKHHIYPVFARRRRRRSLDQDAHFE 315
                                ||.     |.:.|..:      .||:                   
  Fly   187 --------------------GPK-----YPELPAGL------QHIF------------------- 201

  Fly   316 RLHLQQHLSSRQLLFGKIERLYKSRRLNGTSCVLRALCESSQRQQHVLRGTNAVRPQSF-----I 375
                  |...|.||:|.:|....:..::|.:|:||.:||...|..           :.|     :
  Fly   202 ------HGGERVLLYGVVEDFLSTFGMDGKACLLRTICEMHSRSL-----------EKFGVFGEM 249

  Fly   376 MEILSAIFQLPSSDDVEELEELELMISPNYLEAHRQKGNCRQIYGDC 422
            .::...:.:.|.||           :.|:|::| ::.|..:|..|:|
  Fly   250 TKLFLTVTKSPFSD-----------LVPDYVQA-QEVGEGKQAPGEC 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 24/107 (22%)
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 24/132 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.