DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17781 and CG33342

DIOPT Version :9

Sequence 1:NP_651258.1 Gene:CG17781 / 42913 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster


Alignment Length:183 Identity:48/183 - (26%)
Similarity:67/183 - (36%) Gaps:68/183 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 QRIWGPSKWDYAYSQRPREVLRAPPKHHIYPVF-------------ARRRR---RRSLDQDAHFE 315
            |.:||...:...|...|            .|::             ||..|   |..:.||    
  Fly    72 QSVWGFVNYQAQYVPSP------------VPIYWWSFWNTSTFLSTAREWRKGIRSRVFQD---- 120

  Fly   316 RLHLQQHLSSRQLLFGKIER-LYKSRRLNGTSCVLRALCESSQRQ-QHVLRGTNAVRPQSFIMEI 378
                    .:|..|:..:|. |.:....|..:|:|:.:||.|||. .|          .|...||
  Fly   121 --------ETRVWLYDVVETGLERLGDRNAGACLLKCICEISQRPFMH----------NSIFGEI 167

  Fly   379 LSAIFQLPSSDDVEELEELELMISPNYLEAHRQKG----NCRQIYGDCNHTFW 427
            |:|:. :||.|:|.|          .||.| |..|    |||:.|.||:..||
  Fly   168 LNAVL-VPSLDNVPE----------KYLHA-RNAGKAGANCRKTYSDCSKAFW 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 36/113 (32%)
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.