DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17781 and CG42811

DIOPT Version :9

Sequence 1:NP_651258.1 Gene:CG17781 / 42913 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster


Alignment Length:182 Identity:38/182 - (20%)
Similarity:67/182 - (36%) Gaps:66/182 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 WGPSKWDYAYSQRPREVLRAPPKHHIYP-VFARRRRRRSLDQDAHF-----ERLH--------LQ 320
            || .:.:||....|.....|.    |:| .|:|||:|:..::.|.:     ..:|        |.
  Fly    57 WG-LQMNYALPAEPSSFYAAT----IWPDEFSRRRKRQLWNETAKYLPEGVSTMHPSDFTAGELY 116

  Fly   321 QHLSSRQLLFGKIERLYKSRRLNGTSCVLRALCESSQRQQHVLRGTNAVRPQSFIMEILSAIFQL 385
            :.|.:..:.:|..|           ||:||::||.:   :|..:...        ..:|:|:   
  Fly   117 ESLENMLIQYGFDE-----------SCLLRSVCELA---RHPFKDVE--------NNMLTAL--- 156

  Fly   386 PSSDDVEELEELELMISPNYLEAHRQKGNC-RQIYG----------DCNHTF 426
                       |...::|:..||.....|. |::|.          ||.|.:
  Fly   157 -----------LTFTLTPSLHEAFAPGENVYREVYEHAEQQGFLGMDCGHLY 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 22/117 (19%)
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 23/127 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.