DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17782 and CG34442

DIOPT Version :9

Sequence 1:NP_651257.1 Gene:CG17782 / 42912 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 / 5740603 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster


Alignment Length:269 Identity:48/269 - (17%)
Similarity:78/269 - (28%) Gaps:84/269 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 SNSYYSLSPVFRPPMHPSHR-------YADSYYSSRPKGGRRKDNHYYYSRPGVSSSSSNPFAKW 269
            :||.|.:......|:...||       |..:||         :..|.|                 
  Fly    31 TNSEYGIFMAISVPIGLPHRNVFLSYNYEFNYY---------QPEHVY----------------- 69

  Fly   270 TRPYSHAQNSRYPYWALNSRLKDRYYGYKSQQAAPPAAQRRQDSTTTTSAPTTSRPTRRPAPRHH 334
                      :||...:....:|.|..|                      |||.|.......::.
  Fly    70 ----------KYPPILMGQDFEDSYLTY----------------------PTTGREAEGRHCQNC 102

  Fly   335 RIYPVFGKRSIPDAANPHKRQRRSGVATEHEDKMSRLEQLQIKHHRRSRQSLYERIEKYLDKRGH 399
            ..:.:.|.      .|.......|..|...|.:...|         .||...|..:...|.:.|.
  Fly   103 TDWKIEGN------INSTSSNNNSTKAASREKRGLTL---------MSRSVFYAMLRDKLRRSGF 152

  Fly   400 HGHHCVLRTLCETGQKSTEHEPGTFVGELMRAVFTLPEAMDNE-PVAYRDSHYDKAHASKADCAV 463
            ....|:||.:|:| ..|...|...|:|.|:..:|:...:.|.. |..|..:.:|  ...:.:|:.
  Fly   153 PAEPCLLRLICDT-NASQLGEVNGFLGSLVHIIFSPSSSKDEHLPNEYYQAEWD--GREQQECST 214

  Fly   464 LYPECKQSM 472
            ....|..::
  Fly   215 YTKSCDHNI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 22/96 (23%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:285126 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.