DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17782 and CG34443

DIOPT Version :9

Sequence 1:NP_651257.1 Gene:CG17782 / 42912 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 / 5740580 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster


Alignment Length:151 Identity:37/151 - (24%)
Similarity:65/151 - (43%) Gaps:23/151 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 PVFGKRSIPDAANPHKRQRRSG-----VATEHEDKMSRLEQL-QIKHHRRSRQSLYERIEKY--- 393
            |:..:..:.:......|:..:|     |..|:|.....:|:: ::....|..:||..|...|   
  Fly    76 PIESEEVVDETDTETDRKLAAGCQNCTVKEENEAGSEEVEEITEVLPQERKVRSLLTRSNIYRIF 140

  Fly   394 ---LDKRGHHGHHCVLRTLCETGQKSTEHEPGTFVGELMRAVFTLPEAMDNE--PVAYRDSHYD- 452
               |.:.|..|..|:||.:|||.....:...|. :|.||..:|: |.:.::|  |:.|..:.:| 
  Fly   141 VDKLKRSGFRGESCLLRLICETSAAQLDEFNGV-LGSLMHVLFS-PSSSESEDLPLRYYQAEHDG 203

  Fly   453 -KAHASKADCAVLYPECKQSM 472
             ..|     |.|..|.|.:|:
  Fly   204 WNGH-----CHVYEPGCGESI 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 30/105 (29%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.