DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17782 and CG5768

DIOPT Version :9

Sequence 1:NP_651257.1 Gene:CG17782 / 42912 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster


Alignment Length:515 Identity:121/515 - (23%)
Similarity:171/515 - (33%) Gaps:197/515 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TILTLLIVANLVDALKTGESIQLA--------------TGSQPSLSI---NNADDSSLEQLIEMR 74
            |.||||..|.|:...::....:.|              |.:.|..|:   .||.|.. ..|.:..
  Fly     4 TWLTLLFTAWLLGECQSSLPDEFAPPATSHEAGKVNNVTLTPPGHSVVAQGNAQDFD-RDLDQDP 67

  Fly    75 LNESASASYQNNQSASQELLSRKRRYLVFPEGSSFQMVYDEIVGVVDHTN--YLILGITVALAWE 137
            |...|:.|       ||..|||.:|::.||:|||.........||:.:.|  ||.|||...:|::
  Fly    68 LTPHAAPS-------SQRKLSRGKRFVAFPQGSSASGAVCLTTGVIGNPNLLYLSLGINWGVAYD 125

  Fly   138 LPSKPPSEELDDLLTKLEDGTIDISRNDTVSNITYVDVDADATTTTTSRPADYK----------- 191
            ||                             |:|:|..:|...||..|..|..|           
  Fly   126 LP-----------------------------NVTWVLQNAHGWTTKKSAQAQIKRRHRRELYGRL 161

  Fly   192 ------------PNYINLSSYGSSSSSSSSSGSNSYYSLSPVFRPPMHPSHRYADSYYSSRPKGG 244
                        |..:.:......|::|:|:.::|..||.    ...|..||...... ||||  
  Fly   162 ETMIDSRDLWSPPTLMTMMERADDSTASTSTFASSPESLV----TSSHLLHRRWQRAL-SRPK-- 219

  Fly   245 RRKDNHYYYSRPGVSSSS----------SNPFAKWTRPYSHAQNSRYPYWALNSRLKDRYYGYKS 299
                  .|.|.|..||.|          .||                            ||||.|
  Fly   220 ------RYLSFPEGSSFSVAVCFTVGIIGNP----------------------------YYGYNS 250

  Fly   300 QQAAPPAAQRRQDSTTTTSAPTTSRPTRRPAPRHHRIYPVFGKR-----SIPDAANPHKRQRRSG 359
                                                    ||..     .:|:..  ...|...|
  Fly   251 ----------------------------------------FGLNWGVAYDLPNTT--WVLQHLHG 273

  Fly   360 VATEHEDKMSRLEQLQIKHHRRSRQSLYERIEKYLDKRGHHGHHCVLRTLCETGQKSTEHEPGTF 424
            .|| |....:.|       .||||.::|.:||..:|..|::|..|:||||||:.| ..:....:.
  Fly   274 FAT-HPVAPAVL-------RRRSRSAIYRQIEAVVDNMGYNGRDCILRTLCESRQ-YFQRTKMSM 329

  Fly   425 VGELMRAVFTLP-------EAMDNEPVAYRDSHYDKAHASKADCAVLYPECKQSMWQAQF 477
            |||::|.:|:||       |..:|..:.:.|..|..||..  ||...  .|..|:.:..|
  Fly   330 VGEMLRTIFSLPKQRIFTRELHENADIVHYDQAYRNAHTD--DCTQY--NCHFSLLELAF 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 35/103 (34%)
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 35/101 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.