DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17782 and CG7201

DIOPT Version :9

Sequence 1:NP_651257.1 Gene:CG17782 / 42912 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001261574.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster


Alignment Length:227 Identity:51/227 - (22%)
Similarity:85/227 - (37%) Gaps:62/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 AAPPAAQRRQDSTTTTSAPTTSRPTRRPAPRHH-----RIYPV---FGKRSIPDAANP------- 351
            |.||       .|:.|..||.:.|..|..|...     ..:||   |.|..:.|..||       
  Fly    81 ALPP-------GTSLTFVPTIAMPLVRHPPEGFFSNLTISFPVTIDFDKLGLTDNQNPLGDLPPL 138

  Fly   352 ---------------------HKRQRRSGVATE----HEDKMSRLEQ-----------LQIKHHR 380
                                 |.::|:..::.:    :||...|:.:           ||...|.
  Fly   139 FARSFGHEAGHMVGEYVARYLHVQRRKRDLSEQRSRSNEDHPFRIHEEGPKYPELPAGLQHIFHG 203

  Fly   381 RSRQSLYERIEKYLDKRGHHGHHCVLRTLCETGQKSTEHEPGTFVGELMRAVFTLPEA--MDNEP 443
            ..|..||..:|.:|...|..|..|:|||:||...:|.| :.|.| ||:.:...|:.::  .|..|
  Fly   204 GERVLLYGVVEDFLSTFGMDGKACLLRTICEMHSRSLE-KFGVF-GEMTKLFLTVTKSPFSDLVP 266

  Fly   444 VAYRDSHYDKAHASKADCAVLYPECKQSMWQA 475
            ...:.....:...:..:|...:.:|.:|:::|
  Fly   267 DYVQAQEVGEGKQAPGECFPYFKDCPKSIFKA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 26/98 (27%)
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 26/98 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.