DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17782 and CG13869

DIOPT Version :9

Sequence 1:NP_651257.1 Gene:CG17782 / 42912 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster


Alignment Length:225 Identity:48/225 - (21%)
Similarity:80/225 - (35%) Gaps:64/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 RRKDNHYYYSRPGVSSSSSNPFAKWTRPYSHAQNSRYPYWALNSRLKDRYYGYKSQQAAPPAAQR 309
            ||:.....|...||....|.  ..:..|:...:..|...|.:|.     :|.:...| .|....:
  Fly    31 RRQKRFLIYQNGGVIKFVSG--CAFPAPFMEKKAWRQLVWLMNF-----HYQFNEPQ-TPIYWWK 87

  Fly   310 RQDSTTTTSAPTTSRPTRRPAPRHHRIYPVFGKRSIPDAANPHKRQRRSGVATEHEDKMSRL--E 372
            ..|.:.....|.|     :|||           .|:|                      :||  :
  Fly    88 LWDGSRNLKGPLT-----QPAP-----------PSVP----------------------ARLLVD 114

  Fly   373 QLQIKHHRRSRQSLYERIEKYLDKRGHHGHHCVLRTLCETGQKSTEHEPGTFVGELMRAVFTLPE 437
            :.|:        .|::..|.|:::.|.:|..|:.|.:||.||.. ||. |.: .:|:..:....:
  Fly   115 EPQL--------LLFKFAEAYMNQLGQNGSACLDRLICENGQVD-EHS-GLY-AQLLHRLLRPHQ 168

  Fly   438 AMDNEPVAYRDSHYDKAHASKADCAVLYPE 467
            .:|   |.|.|::....|.  .||...:||
  Fly   169 TLD---VRYLDAYRMGRHG--VDCRNAFPE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 24/90 (27%)
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.