DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17782 and CG33262

DIOPT Version :10

Sequence 1:NP_651257.1 Gene:CG17782 / 42912 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster


Alignment Length:80 Identity:21/80 - (26%)
Similarity:37/80 - (46%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 RQSLYERIEKYLDKRGHHGHHCVLRTLCETGQKSTEHEPGTFVGELMRAVFTLPEAMDNEPVAYR 447
            |..||:.||..|:..|.:||.|:|..:||........:..| .||::..:.:....:::|.....
  Fly   110 RWQLYQFIEHMLNGYGLNGHACLLEAICEANNIKFAKDFST-AGEMLHLLLSPSSTLNSESNRAL 173

  Fly   448 DSHYDKAHASKADCA 462
            |....:...|:.||:
  Fly   174 DFILAEKDGSRRDCS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 21/80 (26%)
CG33262NP_996071.2 DM4_12 110..192 CDD:462285 21/80 (26%)

Return to query results.
Submit another query.