DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17782 and CG33262

DIOPT Version :9

Sequence 1:NP_651257.1 Gene:CG17782 / 42912 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster


Alignment Length:80 Identity:21/80 - (26%)
Similarity:37/80 - (46%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 RQSLYERIEKYLDKRGHHGHHCVLRTLCETGQKSTEHEPGTFVGELMRAVFTLPEAMDNEPVAYR 447
            |..||:.||..|:..|.:||.|:|..:||........:..| .||::..:.:....:::|.....
  Fly   110 RWQLYQFIEHMLNGYGLNGHACLLEAICEANNIKFAKDFST-AGEMLHLLLSPSSTLNSESNRAL 173

  Fly   448 DSHYDKAHASKADCA 462
            |....:...|:.||:
  Fly   174 DFILAEKDGSRRDCS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 21/80 (26%)
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.