DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13614 and CG13615

DIOPT Version :9

Sequence 1:NP_651256.2 Gene:CG13614 / 42911 FlyBaseID:FBgn0039194 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_651261.2 Gene:CG13615 / 42916 FlyBaseID:FBgn0039199 Length:331 Species:Drosophila melanogaster


Alignment Length:307 Identity:63/307 - (20%)
Similarity:104/307 - (33%) Gaps:78/307 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILFSFELIHLTLGQVDSNHTELKHVLDRVFSRRKRFVLFPPGSNLKFTGQLSKGLISAYPKGVNM 71
            :.:..|.|||                   ..|:||::.|..||.|..|....|.::...|:|:..
  Fly    39 VTYMHEKIHL-------------------LHRQKRWLTFELGSALTVTANCGKAILDTIPRGLLW 84

  Fly    72 NIEQACYYPVPSKREDVYPKRYRQRTTTTVKPKTTTEPTYVWIPGTNWRFKATPLKKP----MPM 132
            ..|....|.:|:..||..|:.       ..|||....|.....|.........|...|    .|:
  Fly    85 LAEITSLYELPAAIEDWIPRH-------VGKPKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANPV 142

  Fly   133 KLHQRIDVRPQKPSYVDPAKWTHWSKYGNRYENWSPANHNYEKYSQPGRWSKWTTQSPKWSKRWY 197
            .|..:..:.|..|:  ||.:..:::     |....|.....:.|||..:.....|...|      
  Fly   143 SLPPQPVIVPLNPA--DPIQSFYFA-----YPQGIPTLSRRKSYSQQLQMGCPATHLVK------ 194

  Fly   198 RSADGEYYDPEVEPYEDVRSQPLYDPYDPDMTPHEVAH--YRELEH-----LKDMRHYNGHRDRR 255
             ...|.||                      ..|..::.  .||||.     :.:.::.:|     
  Fly   195 -DMYGTYY----------------------CRPSAMSRRLRRELESQGRRVINEAQNPHG----- 231

  Fly   256 QLFEHFDGFSKLLGIDAKACVLRAICDSKRLLLPRGYSMIQDIVRLV 302
            .||:.....:.:.......||:|.:|:::.||.|.|.::..||.|::
  Fly   232 MLFDLISIMATMFNYQPNYCVMRTLCEARHLLAPPGLTLFHDIFRIM 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13614NP_651256.2 DM4_12 249..341 CDD:214785 14/54 (26%)
CG13615NP_651261.2 DM4_12 225..320 CDD:214785 14/59 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010001
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.