DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13614 and CG33339

DIOPT Version :9

Sequence 1:NP_651256.2 Gene:CG13614 / 42911 FlyBaseID:FBgn0039194 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_996280.2 Gene:CG33339 / 2768681 FlyBaseID:FBgn0053339 Length:313 Species:Drosophila melanogaster


Alignment Length:373 Identity:99/373 - (26%)
Similarity:154/373 - (41%) Gaps:98/373 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRVDLLILFSFELIHLTLGQVDSNHTEL--KHVLDRVFSRRKRFVLFPPGSNLKFTGQLSKGLIS 63
            ||..:|:|.....|...:|    |.|.|  ..:.:|:.|||.|.::||..::|..|..|:|.::.
  Fly     1 MRSTILVLLLIGAIRAAIG----NQTHLVGSSLENRILSRRVRALVFPDKASLLLTAALTKLILG 61

  Fly    64 AYPKGVNMNIEQACYYPVPSKREDVYPKRYRQRTTTTVKPKTTTEPTYVWIPGTNWRFKATPLKK 128
            ..|.|:..::|...|.|||...|...||..::     :|||..:.|...:    :|.:..     
  Fly    62 GRPSGLQYSLEFDMYVPVPDTIEGWQPKILKK-----MKPKPMSTPKRRY----DWSYSK----- 112

  Fly   129 PMPMKLHQRIDVRPQK--PSYVDPAKWTHWSKYGNRYENWSPA-NHNYEKYSQPGRWS----KWT 186
                        ||:.  |.|.||.:..|       ||  ||| ||....|....|.|    .|.
  Fly   113 ------------RPESYYPYYADPYRNAH-------YE--SPANNHRVPFYQATSRDSFPQASWH 156

  Fly   187 TQSPK------------------WSKRWYRSAD-GEYYDPEVEPYEDVRSQPLYDPYDPDMTPHE 232
            :.||.                  :...|..||: ...|.||.|.||..           |..|..
  Fly   157 SSSPTNRRKEFYTSRPSLNRASFYHSPWSLSANQRNSYPPEEEVYESW-----------DQVPSW 210

  Fly   233 VAHYRELEHLKDMRHYNGHRDRRQLFEHFDGFSKLLGIDAKACVLRAICDSKRLL---LPRGYSM 294
            ..|             .|:|:||::|:..:...|:..:|.::|:.||:|:.:..|   ..:|: :
  Fly   211 KLH-------------RGYRERREIFDQLEAMGKVFQLDLRSCIKRAMCELRAKLNAGQDQGF-L 261

  Fly   295 IQDIVRLVFTLPTASGVEDDYSRIMQMDADDCDRQFRDSCKLNLLAWL 342
            ::|::|:|.|:|  ..|.||..| .:||..||.|.:..||..|:|.:|
  Fly   262 MEDLMRIVLTVP--EEVADDKYR-HRMDNQDCARFYAPSCPYNVLDFL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13614NP_651256.2 DM4_12 249..341 CDD:214785 31/94 (33%)
CG33339NP_996280.2 DM4_12 215..305 CDD:214785 31/93 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010001
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.