DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13613 and CG34429

DIOPT Version :9

Sequence 1:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097598.1 Gene:CG34429 / 5740606 FlyBaseID:FBgn0085458 Length:249 Species:Drosophila melanogaster


Alignment Length:200 Identity:54/200 - (27%)
Similarity:94/200 - (47%) Gaps:30/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LLFPTS--TVLQLTSSISIPA-DLNTRTKVFMDMGFQMNYNLPPTVS--------------AFYN 77
            |::|.:  |.||:.:...||| ||...: |......:..|.||.:..              ...|
  Fly    44 LIYPRANPTRLQMIAGFGIPAEDLKVES-VITGYVLKAQYYLPYSAKQLRTKDVHEISESRLLQN 107

  Fly    78 ATIWADELSRRQKRQLDHSLDANLQQYDLEGGMHPADFTAGQLYKGIENMLETYGFHRSCLLRSV 142
            |||: |::.:..:::|  ..|.::.|.||: .:....::..:.:..:...::..|  |.|:|:|:
  Fly   108 ATIF-DKVMQMSEQKL--GFDPDILQEDLQ-ALGSYRWSVYEAFTALAIRMKLNG--RVCVLKSI 166

  Fly   143 CELALHPFAEDHFYGMVTQVITFLLTPSQHEGFADD-EQHYRDKYEKAEQIGFLGGQCHLSYPSC 206
            ||.|..||  |...|::.:|:..|||||..   .|. .:|..:.|.:||::|..||.|...||.|
  Fly   167 CESAAAPF--DDRNGLLGEVLHILLTPSSS---VDPLSEHSDNDYLQAERLGAAGGDCDQVYPRC 226

  Fly   207 QADII 211
            ...::
  Fly   227 PKSLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 29/87 (33%)
CG34429NP_001097598.1 DM4_12 137..233 CDD:214785 30/101 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.