DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13613 and CG34443

DIOPT Version :9

Sequence 1:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 / 5740580 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster


Alignment Length:225 Identity:60/225 - (26%)
Similarity:96/225 - (42%) Gaps:33/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LGQVSLLLITLIRPIYGLLLFPTSTVLQLTSSISIPADLNTRTKVFMDMGFQMNYNLPPT---VS 73
            ||.|.||.:.| ......:.|..|:...:.::|::|.:|..| .||:...|:.|||||..   .:
  Fly     8 LGLVFLLTVYL-DLTNSFVAFTASSTHGIFAAIAVPLELPHR-NVFVSYNFEANYNLPANWEKWT 70

  Fly    74 AFYNATIWADELSRRQKRQLDHSLDANLQ----QYDLEGGMHPAD---------------FTAGQ 119
            .|.|..|.::|:......:.|..|.|..|    :.:.|.|....:               .|...
  Fly    71 IFQNGPIESEEVVDETDTETDRKLAAGCQNCTVKEENEAGSEEVEEITEVLPQERKVRSLLTRSN 135

  Fly   120 LYKGIENMLETYGFH-RSCLLRSVCELALHPFAEDHFYGMVTQVITFLLTPSQHEGFADDEQHYR 183
            :|:...:.|:..||. .|||||.:||.:....  |.|.|::..::..|.:||..|     .:...
  Fly   136 IYRIFVDKLKRSGFRGESCLLRLICETSAAQL--DEFNGVLGSLMHVLFSPSSSE-----SEDLP 193

  Fly   184 DKYEKAEQIGFLGGQCHLSYPSCQADIINL 213
            .:|.:||..|: .|.||:..|.|...|:.|
  Fly   194 LRYYQAEHDGW-NGHCHVYEPGCGESILEL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 26/87 (30%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.