DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13613 and CG42812

DIOPT Version :9

Sequence 1:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097901.2 Gene:CG42812 / 50072 FlyBaseID:FBgn0261994 Length:217 Species:Drosophila melanogaster


Alignment Length:209 Identity:92/209 - (44%)
Similarity:133/209 - (63%) Gaps:10/209 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLLITLIRPIYGLLLFPTSTVLQLTSSISIP-ADLNTRTKVFMDMGFQMNYNLPPTVSAFYNATI 80
            :|:|.||.. ...||:|.|:.|.||.|:|.| |:|....::.:|..|.::||.|..::.||:..|
  Fly    10 ILVIFLIHQ-SSSLLWPASSNLGLTLSVSTPIAELYPERRILIDWCFAISYNYPYNLTEFYSIPI 73

  Fly    81 W---ADELSRRQKRQLDHSLDANLQQ---YDLEGGMHPADFTAGQLYKGIENMLETYGFHRSCLL 139
            |   |:..::|:..||:.: |.|...   :|...||||.||:||:||..:|:.|..||||.:|||
  Fly    74 WPGFANYKAKREVPQLEMT-DENFYTKYGHDNGNGMHPKDFSAGELYAFLEDTLTGYGFHETCLL 137

  Fly   140 RSVCELALHPFAEDHFYGMVTQVITFLLTPSQHEGFADDEQHYRDKYEKAEQIGFLGGQCHLSYP 204
            |||||||.|||.:.|.: :::.::||:|:|||||||.|||..||..||.|||.||||..|...|.
  Fly   138 RSVCELAQHPFDDSHQH-LLSDIVTFVLSPSQHEGFRDDEDVYRKAYELAEQDGFLGRDCLRLYS 201

  Fly   205 SCQADIINLATRLV 218
            .|:.||:.|.::::
  Fly   202 HCKHDILQLMSQVI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 48/86 (56%)
CG42812NP_001097901.2 DM4_12 110..210 CDD:214785 56/100 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469010
Domainoid 1 1.000 81 1.000 Domainoid score I15299
eggNOG 1 0.900 - - E1_2C43J
Homologene 1 1.000 - - H129747
Inparanoid 1 1.050 112 1.000 Inparanoid score I7207
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26140
OrthoDB 1 1.010 - - D120231at33392
OrthoFinder 1 1.000 - - FOG0016872
OrthoInspector 1 1.000 - - mtm9698
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10547
1211.910

Return to query results.
Submit another query.